ELFa(X44 (444@7 /lib/ld-linux.so.2GNUaoNj{c 4fG dY86F;Mxuaszmn_wE*g}UtJ,R  O9ypq3]hKiD X/%>1#)\|Q~v[e& '!(.7$-":C<0L+A=SZTbIWk2B@lrVP`^H?5vܖ0 H$0<< H&T<`ll9xD$ "1t(p0,̗dؗ08d(c ?, \8|D|KP\h_t LGTLt7ȘԘz +(p"F4@@|LXd tp| ? <TęP!ЙLܙ`>\/ ,$ s0<1[HLT4`Ll x`tI Hc̚0ؚ$xL0  P ],<8XDP\0ghtn2 jt7țBDwlԛ:t00xU  (t4  gL libdl.so.2_Jv_RegisterClasses__gmon_start__librt.so.1clock_gettimeclock_getreslibc.so.6putcharstrcpyioctlsysconfstdoututimerecvconnectfdopenmemmovegetopt_longftello64getenv__rawmemchr__strtol_internalqsortfgets__strtoll_internalmemcpysetitimerperrorreadlinkgetuidfeofmallocisattysiglongjmpoptargvsnprintfsocketselectfflushstrncasecmpfreeaddrinfoabortchmod__sigsetjmpacceptrenamestrrchrnanosleepcallocgai_strerrorstrcatbind__deregister_frame_infosetsockoptoptindstdinfnmatchmktimeferrorstrstrsignalstrncmpstrncpyunlinkfreopen64strcasecmprealloc__strdupstrtokmemcmplistenforksscanffread__xstat64symlinklocaltimememsetsrandinet_ntoa__assert_failstrcmpgetpwuidfgetcsprintffclosegetpeernamestderr__lxstat64fputctimegmgetaddrinfofwriteaccessstrptime__errno_locationexitinet_ntop_IO_putcfileno_IO_stdin_used__libc_start_mainstrlenstrchrfputssetsidfseeko64mkdir__register_frame_info__fxstat64vfprintfstrpbrkfreegetsocknamefopen64__fini_array_end__fini_array_start__init_array_end__init_array_startGLIBC_2.2GLIBC_2.2.3GLIBC_2.1GLIBC_2.0/ ii UUii Usi _ii kii u|INq67or|        $!(",#0$4%8&<'@(D)H*L+P,T-X.\/`0d1h2l3p4t5x8|9:;<=>?@ABCDEFGHJKLMOPQRSTUVWXYZ[\]^ _`abc d$e(f,g0h4i8j<k@lDmHnLpPtTuXv\w`xdyh{l}p~tx-t낐-/Ə2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌ|Ə2ʌtƏ2ʌlƏ2ʌdƏ2ʌ\Ə2ʌTƏ2ʌLƏ2ʌDƏ2ʌ<Ə2ʌ4Ə2ʌ,Ə2ʌ$Ə2ʌƏ2ʌƏ2ʌ Ə2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌ|Ə2ʌtƏ2ʌlƏ2ʌdƏ2ʌ\Ə2ʌTƏ2ʌLƏ2ʌDƏ2ʌ<Ə2ʌ4Ə2ʌ,Ə2ʌ$Ə2ʌƏ2ʌƏ2ʌ Ə2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌ|Ə2ʌtƏ2ʌlƏ2ʌdƏ2ʌ\Ə2ʌTƏ2ʌLƏ2ʌDƏ2ʌ<Ə2ʌ4Ə2ʌ,Ə2ʌ$Ə2ʌƏ2ʌƏ2ʌ Ə2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌƏ2ʌ|Ə2ʌtƏ2ʌlƏ2ʌdƏ2ʌ\Ə2ʌTƏ2ʌLƏ2ʌDƏ2ʌ<Ə2ʌ4Ə2ʌ,Ə2ʌ$$  --0-n1t - 0  R /)0@-\P0S0P@0 R 00/0 R 0S/000(E-<0-S44/,, 0SR/䐗E-0@-P\@ \ 00!$,!,0 000000 $, , 0 0000-0S S@-@ E 0@-0MR0P @ R   P Q Q  P0 0,1 S Ѝ0@@0D 0,1S w.(OSp. HSĄ`0@^PS \P]P P 00 RePoP/qP /ĄC-Mp 00\2 A 0Œ``P PG00壈 0 ۇP ֈ;p儀 0@P0S Ѝ耄.A@-pM@0` 0ԉP 0 P@ @  ,1@S,Ѝn00RĄ,0@-0MPP0S2 A0Ì 0Pp3Ѝ0E-PP`p㬆@p`0 0 $0Pp 0  ,8 000 !+1.0[\XLTt-0+\MA-M0@0p`0 TP0@0 0KP V \ 00 0/@T  ЍAЍ/ 0@T&n0 0ĄMO-M(01@\(` P 0P䠟䀟, +0P00@00 pP U \   0/  p0S ЍOЍ/$$ 0R0P\ X$MO-M(01P\(` @ 0P蠟耟- V+0@00P00 pLP T \   0/  0rp0S ЍOЍ/$$ 0R0@\(X,MG-M$001@\`  0P q Q +000@V ЍGЍ/pP 0R0($0 P X \   0/P``V  p40S \0X4p@-PPp`P *@P 0S /)uH 000p@,0,!RTpQ\XĄ`A-p@PM  @`PPC0   $S PP1@,1S10SD RP!0S S ("4<"<0,1S + \PPЍ}` w`PĄpO-RBMP`ᄠ +@ ZPf 0P  ``P9r1S]0R00=pP 2PU_ B0S~ @0 0X"@鞂@P0sy S Y,}P,1S WPEn00BV@PY - ePP`Bߍ Q<1 A?[ O0 |PLPB?  #) IP,1S (P+P/ *A + 80e bP 0r &0Sy  Q03g0Sj000}L0  p1<O0cĄTPDPd8G-Mp+PP    3*T2* `P@z*0S*P *^+PPc`Ѝy***`0@-0@S  >S<S "S S 0S &S0S⃃ R3  &@;tP 0BS=갯,,,,,,,,,,,,,,,,,,,,,,,,,4,4#003 0 0@ R0 00q00u 0C 0@Pa0m 0 @0P<Sg0l00 p-LM@`X0 T 0P0 c@ qP0S# P KpP  b@L @T0( N6(0hE-@P'P"P`p"@PEgPT * d0#S &S  RZ@@MQ `0l -L`p/@@ @@ d-QQ 0O  0(K p-P1L @R P0SKpS #S %S 0S S #S %SQ  `-1Q 2@%`3P%Q500@ ?Q #Q Q00`@P$0h!RF00`PĄ0@-P@P0&fd04 0 5'4@G- R`MPpI PH  0'P  @P, R 0S R4 &20P@ ' 0{'P  1P @ 'Ѝ&  '' R 0S R Q R0S  0/S 0p/S HOPe'P 0S0S l4 @-Pp@P PP &`P E'PP嫁@ᨁ @Z'&& 03l4,'p@-P@0MSp` 0S  0&P &劁刁$Ѝp&&l40@-,P@0S 0@}{&00@-@P }%00t@P }%00T0P}H@P < (&%00$0P@}l40dhp@-PM@` PP m&P Ѝp0P c&PTԹܹ'&0@0$P &0000d` -L8M[EL P %PH (K10 cX c}H R0P0 QP T TX $5q&@P ,1S 0P @@T 0P004%`PA 00孀$,1S  aLt |LZ 0 SRQ18LP0 0P0 dTH\T L[/ 誂@PLZ0#$P00P 0LL0ß00,1`S L|P )H41SPP@PD   @R @ < 0@0 P<0 0SŸ,1S PU  RŸ,1S0`SDZ ;|< @0K dD00@Sꜽtܾ0 S 0S4  00 @408 Q0ӹ848/0`@WD 0@t,1S8<  < 00,0 0`@hD 0@,1S@  @ D 0@~,1S% kK!KSUG 0~KLPJ < 0tsK { D 0@@@0lĄ4t$@ 8t\T x0 /S00000 0S0@f D 0~@\@ O /\0@ S\  D cD0 0K S{8@` `0 `V@08, Ja0@JPJ 0h8 pJ5,| 0JK-@-~@>$00-,~00Q/ 0 Q/p@-@P~P~ P~$P~@~A-P$$@P `p(0p@S IP  DP 0Sp00@O-(M@P $0$P  PI  $AT lP@M O P &BP|`(1PP00  x 0SX0Sl$x P@2 P0 P$PB 0p d h0 M M0`S+\@Kl P \0S9 S$P l< K$P6$P < Klk.Tl,AAlB00L4 0S0S00 ;00 40S0S0A<$P @d dA @d Y UOP`` tP+pQ^ ,T0S t0SW x0  0  K K PU  > d Rp :@T 0 K]81SY@0S 0S01S,0S0S @T xw` KR00 x pD @ 0 K  U0PK``x` DKh `p(VPtd pDKY`h,ɟ0S 0D @p\@ 0L@l@00lP00P06@ @ʟ$1S,l4  0@St 0D*Sttttt8tttttttttttttttttttttttttttttttthU ` IT0S l-00h),''@2h$P l< K 0@*S~0ttttttt8ttttttttttttttttttttttttttttttth? C@C0a@D0CS! 0R B/S 4T@pg@$ATN$? (@Gh'$APT/ lKP@#  P"$AT ` D@`@ 0:S6$P @5@2@l@00t)@&@l4@00D@|@l@00L$P8 l=P@0 Pj P6$0p03T0SP lP@ P P0S %$P 5P$P l&P@  Ph5$P @`?T?l> @00G?(?l2 @00;? ğ,1S< Ph J`l00xP<@3 0i?P@ ?h?l Pa \0S= S\4$P ,@Kl( P 0@2SN0ttttttt|tttttTtttttttttttttttttttttttttttttttttB?$??l,@b$AT @d h m8??l, @ ?l?lwt,r4@}> >d@o>>lZW,U@`> @i@> > >lD00N>\@K8T`h d<lpplD 0dT(Tt4@Pd8| t4,l" Ąp$Pt h `@0/S~[000S  ./S0S0] 0 ,1SPp> ,1S  =P $P1 l,K'@Py 4TH9>6>l0h0,T(>K}o, =<@"1HC/1X>,Ph  =0S $ATY$+= =l$ P@ PPR$P=  @P`: K x`Y@="$PT=\= K k=0`0 u u l8K P$ u  0Lz==l@00#@?V'= =1@" 0Y=l00h,@3$Pk ly=$T$PO lq P@c ? PA$Pg=  @P` = Z=$<  =h,4=O@I=D$GVT,1SPK`|:=d@  @h 3=QP-qq8 <B%=8"=<,1S  0<P= = 2=((&0@ <$1S< `<8p<xxx&x6tP[.@P` ](`VT$V,1S <j@Pqk0S5 <l700h3,1@<< 4d<(,1S/00Va 0 .S/0 R00x0,!R G<D<,1S =<802S pu  0P<<@|pu@ l000$1S. 0+ XTPP+ k@P# T:; %<Up<x  0P S S 0P S S @0T0@:`'@@ 0 ;'@@-@p P`'pP$p"pU`V PP0@-@P0 PpPppU@0O-P aM0@R |1A" @0S _P  ;@aߍ qo@0T@0 #20 0 S a 0s0Sh[`p_o _0@Sj \ 0|1A 0_P0@s000 00@ 3S񟗚DDDD(DDDD80s0S G/gP,1: SRoNZd m[P  @< 0@; Bo \|0@|1A{ 1RBw^T\pf 0[T@bTK 0S0S , H1Sd 0S@@ $STM 0S' S%p 0} q)@00 @T  |1R ST`V d_0@\ 6JX _2l0h :>00_?P RpPn%X 10 1_0@,1S% o:%P :, d:zY@_k P0R:na)@,+:Ą,Xdt G-0P00 pW@QhА`^n,1S)` G@T00 H1SGn000P @ :0 :O9Ą$ H -L,tM((~ P \,1SD0L p0(K RI 0`  000    S    £  F0 l0S^Z $ m YRW01SZ @TQ  T,0S pT 0 Rss Q 0 s 3\ R7,1Sm  YmW3W W 0 `0V00S (p P Sp00C00S03p0C0y KPd @1S &\ Q0SK0S  KP|@\x0p: S @8 0 *9p T9@p~8 9@pu 9y0Sn0q\P P9 2 R0g \c0SU  @pO0\KSS@&0S  0@R@\00S/T$  8@00 '48 8@p)P0. 0S @T1,!RR d8NAjX 8@  48@ 8@p  y8fX 8k 0Hg800 c-!!  W@ pP?@7 0hj8@p ptĄtl|DHXr pG-0M00 `P p ЍDX0Si Q@$ 0S PgPP9 @TPU @0/S EP P 7 8 PU$0S# ZZ Q@?T7 $ Pu = U @@[7  7 @Q  F0 0S3 0S\0Su-Z$*7d 7@ 0<7000 jĄtxtt A-M$p0h0`x dlp|t0P S``聟0 S6 0S(0S  2@ T@ T hpxPk|0Px0kЍ0Q @ T@000@/PeP  P@L1S T0SP ik`  P@ nkP@|PT`0S 0S L &7 WP,h0 7Ą -PQL 1F0 0S 0S PU1F0 0S 3(K0St1F0S-  p`@@0S00 c0-!S /S0S0  q ,1S) Le@P 6 60S0  W0 00j @V  MVj<v6 ,1S $ 0m6Ątp<@-@p`5 z600  00  00  0 S& jNPP P0P @ S 0 S`Ax $1S,1S 5H)6U`@* @(@ `P$d<Ą8 -LM@QPU 1Qq x1UY@$1S d HP8PG6K01,!R 050S S* S ' 0S Q SR  ``0S   S S0S|p,1S@t 5  @Yg$0S# C0  100C 0PPPP U g#0 0S#<<<#<38(4#(3Q ,Q`"0\ ,\QPQ00 SP00Q0SQP0 00`0  01000C00 ,PPQ 00` `100`C 0Q ,QPV 0`` 1000C ` PP| ,Py 0PP 1000C P[ 000$A0 ,1S|f ,100C 0tY00@$ ,1S 5  2,1S|\x \0l2,1S X1,1S D1d<pB,CĄp@-QMP`' R* 1R@ t18Pf4ЍpfX P@02S f$   ! 1!00,!R$(?Pe#!0N]S0^QP 00 ^0)Se \~1@100C 0$x(p8Ąd<0p@- M@ `  @IP|0 @P4@e Ѝpe P@ 02S e@@p@-PM @v 0P4`xeЍpse P`0 5Rge`2R ae`Hp@-`Mb@B x0eP4PDeЍp?e PP 03S 3e PLp@-PM@ 0;P4`eЍpeZ P`0 5R e`1R e`Tp@-PM@ 0 P4`dЍpd* P`0 5Rd`1R d`\@-PMpH`@` 01`Pd4Ѝd P05S @P00d dP |P00`P PP00 8P0000d2lpxp@-PM`@U 0xPXd4@ЍpRd P@05SGd@H<PP P;d*d6dA-PM`@p 0p=P4d@0ЍdY P 0@P05S 0@p 80S cc@-@P0  RPP 0Id:@-@P 0 S0C RL0 00B0 SL 0C 0Q  0 Q0Q G-鈔MPpU`@  (P J,P J@P 8 44RcTc3 0 0 0 0 0 0VF0Q_ j:Q p 0 0@L 0/S / C 0 RQ<0ST  0SW 0 0SZ S|  7c `V_ 0 0sf @ ` v.1 L R 0,Q 0@ Rb 0~/S0S/J e0S/@0d b0S_X P .b `V0 K b0S K Ѝ 0B 0C 800@ D0<  a4]PJxЍ 0^-P FR0010!>C00C00,1SKPFPp p W@~ P Z3 @[A #00P py X\%,1S pPb 5-P p[ 0   100C 0`:\A @@=0dU0  @ @D[*00 [T @RP8P%,1S: ,`8 4,!R0TP/ahPk +a )ai4,!RP ,P@@0   1000C 00`q0"S X\ }U@0k0cP 00P R #0Q> 0S:#,1ST P@@P 0rS 00wQsRxR  00P@Cd,1Sv d,r0,!P0R\ [,Yh0SPh0Q 0RG @PW` TUN P@TB T_ Td0I} T 0P*Sy@@,1Ss <+,T Pq1,!0RP0!  ,AP ,1S ,$%`@P 0 0 ` `n 0Sp +PT 0P/S=@D(@@,1S6 X+T P4D)@P '`h,1S00BT 0P@S@D @@,1S +T P+d+++T @P 0+  Ht+2Ąd<kh <lT0H t O-PxMQ>>0C>|+Q$$xЍJ$D@P@3 :[P_6[P_2[P_$ +[P P غP,1@@S80;SS   0;SS;S;0C0PEPE~_,!XR0US0RT0 0\ `00@\0`@P ,1YS@P ,1S0 \`P IPP@ P U9E`a0\aEP 0 <,1v^@S PE@P  0-0 S :SS 0 S :SS@R_0 S :SS 0 S :SS@RpV,1S0 @40(0H0(p,0 8`00tU@0@ 0kU@0@ 0]bU@0@ 0YU@0@ 0@V 20"0,0uS)0oS&0tS#V0;S@"00V 0"00pS 0oS 0sSV0;S'000xSJ V0   100CV00Y0S T1 X Y  V0;Sy0  0@V 0 00tSV0;S@<00u 0c@Vx0    @P "d00@0ه70CV00Y0S 0  d;d<|d: -`a pP0L c-AQ01 PKO-QM 0p> 08 N 0 "$"22@ B< jQP  W0!S< /S@ P" @!0A]S  =Q R >Q /Q @W2S] "$0^"22ߍTPWU `  0@ `W2S 8L W  !W) 0B S+hm|mdnnnnnno0oDo0Z*0-S0 -SW 0-S >S0-S0-S0S W|0TR !Q 0A5S񟗔pmpmoopmoooooooooooooooooopmoooooooooooo`ooooooooooooooooo`m-Q< !0A0]S  =Q R >Q/Q^ y-Q W B-Q o-Q l  i-Q d-Q a'Q"Q0 W X Q0 \ &68 -G R >QP PPM00 0@0+ W *!0A0]S  =Q RM >Q/QJ    20Q -SI W<0-S >S0-S00/P* >Q 44!0A]S  =Q R >Q /Q 4W4 !0P4Q `0 @. `W W@l 0 @m T0a0S -Pe >P0#3#3#3!0A]S  =Q RL >QJ 4 0( $ ,0UaT4 P[ ^0P0PQ U 0S RP 2@A!^04 020,0 $(00`P 0( _>QV /Q >Q =QW@a 0@0 T'\"\`W   P 0  W P S >P>Q `W0 @ V $(` `,z`WL2 $ (`,m$ (`,fU  WR !@s@P q 0R1" 0 0 \0  ~" 0/ Wzd<A3FaG-pW @P`PW` UP@0ZPO-M`pT9PP0 -<렑@,1SB >PP6 Q,1S? Q 0 0X c 0P0 0/S0000SЍ000PUܐ,1S)X =PP,1S$,1SQ  |0@[lW 0Tq D K8  F(  AĄp(PO-`PM0 S0! ZC 0Sz> PÊ p ЍPp Z0 0!1V @ PP PU 0 @V P  08P  0000 00 0lz0@-M@P x@P0 P 000   PQ0S ?;Ѝ0P 0@-@MP8 P0 P000Ѝ0h0@-MP@ P0 @P \ PPL P@000Ѝ0P 0 00 Hp@-PM(` @ P P' T  P ЍpPP P00 0P@^  eP0P00,ST _P H 00@@ 100@C 0;Q0 @'0US0 RR0 LR0=S00 @ 00 @0 CP  @@  0 000 @ 0 @*@XL` d<d:0@-D0@P`0P  0/ 0뼄$O-(M@KPv 0,1S|T@b0@@ T 0$   q @\ 0!P@ ,1Se[00POK (ЍQ0p @!{T P0x0S Q@ IQt0S t0PQ @ PZQ)P pP@ JU@P @ AU3% 0`\L  <3z 0 .Ą\}|hxlt 8PO- MKPl ,1Srp@T0#0%:iK Ѝ00!P =PP 9@NOPa;@P9 FO O0@S00V@*  dP``T!!*00 @0` Q 00 @0QA0 @ P : 6t 0O 08PL  Ąd<ht 8- 0Pa0 R[꼄@-0@S S S@NN@NO-Rp+ PU  Rڅ01 P P@`V @  P` 00xN PSSON -`L:pP @f00 c-Q  !0T0 @@fN 0 $K00 @@d< -LM4 N@K p@ @W,@ B,  00 c080 =@  8b`8  ppP1P@ `Tp O 0 pS,0000 ,8 00b0 PR 0 0 PN\1,!RO,04 8@1P1@P9(KP`@, @`@@W,@ P ` P `@ P:0 0 pP@  0 0 0p S ʬvh< ,,, ,0X(8wĄLk p@-PPM 0SPMp@M`@` 0 @VQ0@-P@%R PAP*A0 S ^ 0 SP"*0 S0 S@@0QA@pO-@MTpP0`Ѝ0S SU``000[ 10[` P 0eY 0:S P0 P:0(00X0 @ 0` P 00 @0[0 @ K P:d<-M00 Ѝ0@-MP@ 0P0 T D0Ѝ00@@cT@ 000-M 0P};ЍE-0MqP`2 V ߍrHH -D1^ U4,1S<V1ppGV  U*08P,!0OPU`RVU,1S,R,1S P|tGU P=I86$xĄ0@-X0XP,!TRHP H0@@jL00@@@@@0Ą(<0@-@PVL PSL$PPL0$00 0@-Q,M` p@ @@@ @@@@@ @$@(@+P 0 @Q! GQ -Q+Q00 l0PU,Ѝ0 @ 0 @0MS0TS d< -L@pPP00 c-aa 0TiL ?C10 c-AAP @J :KHVUUUP@-<@0#"^ 00  0 0X -LM %0 00ş% `00X u0 @ 00 @`XP P2Q"0 @=QQ0 @"Q0PS  "S@  R"RR@ PrK:0fQZ0 S =SS 0 S =SS`R 0Q 0 @ 0 @`"Q 00 S ,SS 0 S ,SS`R`X{h3P Xß 0 RS 0\S R  ` @  P8`K   YPK  \ zzpKwp m iP b ^  ZXK@@@l!@0ScJ< 00.0똁0(,@,K0 K, 0@ ,0S/ 0,0 Q& ,0 P Q < 0 P  -P Q PQ   h 0AA 嘁:PPP @1T $=U  8  0`^ t1@S1SE ,0@P v 0\! X1 WKFmI 0 PLQ Q@ (0@Qp | t x T `P!@=  1R@|X8 |Pk QD ,1S<|\!\P\;^+ 0,pp|h8,Ph  ,1SHh0 @Sp7 Pp`U QPPUQ Hp1@0S S S  EP@ 0 S S ` ߿@0 S0Uw01Wb 0U 0dS1 P $1SU 0!@T 0@1 A AtD `0, F@dA 9\d1l^00S|: R d|A0T || x0P0#,0S 00S 8pKx!4K 0p@ 8`40PfUZU" 0p@wt 2(KQPPSQ~ ;Hpx8 PU 0,ɟ0 @ 00 c@$Aq b01 㧿P0 @Q M0 7@0BS,0 # DSZ d ㋿PU 0T0 @T\ dp|  P K먾qPA\X0T0  ,1S)P `p?PX^  XQ*ځ00T7 R <7| R |I 4b 0Sx0Qu P P`K P_ `'PP@TA b @]T[ PFL 0 |1 p 0 do,1S0SD `VP@?@T P: <оP 0BS d ! B = 0B 0$ꄁx`0, 0[P xu0 `S@X P|0^ |@@GG#,1 Sp1 ` 0d 1S\ X nK  <*Pq ֽ@p 0lp   hPQZ  R0@U  R 0RB S; 0 S @ 0l  #0 R< 0@bK|PS dP㼃\3 R |0Q |c |! NHD5 0  pp"0\*B!嘁2 0B( 0 5 @@"0*Ђ1U51(,PQ   0@ 㣽PU0/S] HŸ0 @(0aS$0  0  A0  1 !!010S=C0CU1 0封0 @0`0匁0 @ Q4PĄ HPdpt|x$@d:(xT8(P4<lp@3  lpPĄt (<d< 0 3 cPD0 @/  t! E0x1 \PP*0᡼P WOK0@TPQ 1|P0O`p 0@i @PP1SAA-g \1SZ "2<Q0S0U5p\ X q;A, 0c@0\1 XA NK  | R\>| R&A@0;PP0S@0 -> R|̼ 㺹PK1[:S0 @ 0 @Q 40  pP``/A10Ap/%Op-^~0O0 w ğ0 /Qo00 i 0DŸ0 P`b((("(2劸$ APpppg TPppjf1 |1R|g,o.@@P P[ PV ὸpA@0 D۸@0S 0S01S,0S0S p pp4!@0 @뜁@0:1P A$A$?Q||8 dA \|/ 40| Rd<4(4<DX0 R/0|@Ą- 0P\A0 R(@ -L{MX}t ^,   ` 4M0 S" xQ ]0Sd 0@S@pKD 㕸Y1 0S+ 0 儠Z00? 4` P@ 00 cR@`01S !  0 ! 1 ! 0 @! A %%E00@ST0S0,Q00S 0  0SXp0K`0 \@ @TXʼ0S   pK 0PS000 TP @!0E4SԼԼ̾̾̾̾̾̾̾̾̾̾̾̾̾̾̾̾̾̾̾̾̾̾̾̾ԼHо̾̾̾̾̾̾̾ԼԼ̾Լ41S@K 00 ᡷ4 @K✷ ့Pa  0! 1 K ! a00 oPP000S1   ! 1 M[ 00@ 0t pK,PJ@(K/P' 00 0 @0 00 ;P0  ,P /@P!K:P '   K$P>0: S;  * +^K` *Xl  \0  @0S i)(0K#Y00 P 0-S0S儠Z0000@  @X 0@`0 \@ ~00Ꞷ@0P \ 01S PP[ vp @ QQ  A0P 0Rt0 Q h0Ks  !R6 wK< m pKA pK:#U 0S X)P?tU pK),PP6 ?P3T0S pK,PP* t?P'pK,P<P [?|!r T0S7p0hKS X0S q rP 5 R .T0S2 B< K DK@/#pPK`h0KS ? XQ s T`S^<!1 <#pK PPUZs o<PhKk<@᫵坵!1xP@ #pK ! iT0C 1$0 1 P` `| 㥽pKN(0K `0 \@ Y' P$ >=(0 P 0-S 0S儠Z-00*>HH  pKX,P"Pe >"Pb,>((0K#Y00  l0S>Dt!c t\ 0p 1@0 1 tn;@!1X@E "pK \ (f ;@hK;1!@" pK!@;PhK;!0P  pPK`I00P0S3 LH@g !0@ - sLH@Z  0 ,PPv;!1 pK1@j;!0 pPK`t(@ =Ą@Dl|P$XdD||t|<\A-HpPg`0@ P`DPV@-8>P =մVPP -Lp᜴@Q\Th#QQ0S W!`!Ÿ51*0 _Q -QTP`*00 @0a Q 00 @T^ 0=S[PF:P,+@g00 c-Qa {0 1-T_T@ @T@up00(K0 @ Q0 0@T0T0 @ 0@DT0S0 @0D0 @P0e PU 00 @0d<gPA-Pp` d0,!R\@ 01 444 40剳@0! 0Ąe< O-|MpPK h00@Y8PPPP`!  0 "P'lD 0@<`P< P<<58PP@Pܳv3Ѝ 0@ `w P d0@`<0< P@4& 0$H0 T  p@-Aj/0P0 0 (0tQ8PPPLQPPP + 0`12 0C\!1S/ 0+0DQP QHQT!X1pPP+P`&̲@P 0S'PPp$+@A<Tp+P 売P0 0売V p@*<t9`5`+P <@Ppd808 00兲[ @Ą       -Lp@`  `-1Q-  V  P K 0m+, }L @- M 0@!P  P ;; Ѝ$0$ 03 @ -000MoS yS( 1S0S 00nS20 oR) 0 0 Ѝ00nS fS0 fR0S00 eR0 sR0S 0S 0S00S0S0d;d p@-0MsSP`@ d00oS yS) 1S?0S00Ѝp00nS( fS0 fR' P0 yP0 0 0@埱0 eR0 sR0S00S00S00nS0 oR0S00S0S0d;   E-M@T!0#*:P S@P*q0  0QQ``PZ0S !M 0 00PB  \,1, 0 @9Ѝp0 @ 0d P* 0 @+Q-Q"-Q00P*p0  0a\``0S ! 0 c00P  \0^\d< p@-@P0`ṱ0P 0pp@r 0@-PP@e:T:0@-PP@Z:0 R 0~S B:0`/SpP 8P 0/S  l0?) 0R/S@0Q0B0 B 0S/S  0/S `H@-@P@ T*0R B/S 0T00 B*0S/S 0@-@TP @(606@0@-@T` (pP @TP ְP 0R/S/0C0BP @T55@O-PMF*̡0 @` 0```V9 0 @+Q-Q000 l1@ 0@-Q`XP Y 1 @ 0 0@ 0@ p0 .W R* Ѝ@T 0:@0GP: 09`` 0 : 0G: x; 09`0`0d<?$@A-M@;(P0U 0R+ T*0\0 @ 0L T*0S0 @ T \!0g0C Sbl0Ѝ 0R 0S 0(aLp T!: P  -P 0 0;P0 l:0L T`p!*0 @ 0` P 00 @0\0 @ L P:@`Lp4`Lp(`p d<d;ApB0A@?p@-` M@P^0@P8 ; Ѝp  `$ p@-` M@PA0@P8 ; Ѝp  `$ A-p M@fT(:T P!0d0CS04444444444440444t1t 0h@0 Ѝ0PL0 @ 0@T*0S0 @@Q`T*00 @0d @T 00 @0P0 @ @PT  GP 0 90@4P`XP@`@P`@P`u"A @@d;H d<?N@4 -3P( ,0S0000Ąp@-PMU`@9 : U RV00S 0 0`90Ѝp P@300 @ 0: S S:S 0@ V00S@30Pl Ąd< -P L1SH1Ą-M P 0S4 00 S0,H1( 0 ЍĄ@-l@MpP`᧮P @V<0< 00P˭Ѝ 0 X  hp@-@MP 0@PHH` P<7+7Ѝp P夭 Ą0 -nP$ 0S00S,܄ĄE-@M,]쀟PPqa3  dR" R' R 0 0@sЍP`0SaqhWP`PPp8Pp ʭPĄ    @-M OP(  0@0@0@ЍĄ0@-P@ MP0HH@ D D PЍ0<P66< Ą 0 R/p@-(0`A R 60000tO-`0S,  ɬPK Z !0S!p00!11cXA1 $0ZL! 0S0S000S00 `0S!011cqY ;P@ 60 0Z00  P00@ PU@5 < 70  .ppt$0 R/0P 0/++-P}0 +E-MPp0 R+ @ T`@ `0np@ T @5 @ЍF ᷬP5P0 RH0     ᘬ0 R0   ++@-@@0SP(0 R0000+ 0 /+p@-`PM 0R0P Ѝpp0 d0 ߬PT0  @0D P@ 0 㶬7(++p @-X@PレL0D0 @@T 0 0+++pRRG-P`  a0Sq@H 0 0@ST? \\1 ႁU 000P@ 0T4U@  U2 ߫P 0 1 #000 00 0@P00  ?C0 c` 0 T@," 00\  0ad<PXVUUU |   \ % 0@-@PP4T0XA-lM`V Ѝ0P 0.@1P8 414 0(4aPP@$ t" 0S" @Tp@11c1@PuT0@S0S !0!b1Pe0 lpT0L@ `ߪP@ 0<ժ40`L +T pt+  +-p@-h0M,! `RЍp@Ѝ/@00S000$@ P  @@P Ą+-p@-M@ `n0 RT :T 0000$@ P  @!P Ѝp@ Ѝ/D0 R00 R  0S0S +Ą0@-@P<P0T :T" ڪ0 R0 R0  00@p0 R0ƪH0 R L80 R 0$ 0S00S 0++Ą(0S0 R00 0/L+T0ªp@-404廪(@(`o_卪U,@@-P0P@L妪2 0<  0,0$; Ϊ, -@-,. -LM / 坪;P0*000`䊟0SX 0s Q0 S" `oV0$  11@Tp |Z2Q@ `p `: e0B" C0S0Q0 `90oV00Wl0(pK0')9pRpY؉\ ,0sW " ;1AQEt(0r0p p`PX9 R8) *n0o 0A0C 0z00P00+ 000S 1R  yR8Q(\ 0,0 d(h8pp|h(0Sl1(S0s S01Su1Sj8x0QU 0HS0S10 cX Ӯ0H 1,1S7P 0-S 7R7P KPs Ph`  H0SP @P d1PS4PX20PU20S 0 S4 0 l1S08K0K4 Kd1PS 0!P ,1Sp0 0巨P ̨徨L  0,0 WQ5  0,0 J 0,0 E 0,0 = 0,0 6!0,0 10 R+ `H0B.SR4\p?P X40 0S,0 oR P  R0,0   L  3$孨 /妨ݨ LP P8 K80PS 0Sl1XSz s @`. 0 a4X*/0SE81 Q 00 \X ӧ .0E(az0 [00//d;hxtL2Ąp ' H..ht80h.|.b0/p/4//l0| 0.///@-@T, ( (0 T(@000 /,0, 0 $0$ 0 /#EgܺvT200  00 /O-0M0Q00 0 0  [1* 0* 0 0#0(0 , 0)0 0#0 0a 0"0 0# 0 00" 00"0`ȟ 0 lŀ0!0 0!0@  0  00 0 H@dJ0,00,0( '0.00.0a0$ 00$ 0ǟ ́0"$0 0"0@n 0!(00!0 )+BO B'0,,00,0\G@dE0.0`00.0< 0"400"0ǟ lʀ0$8P0 0$0  0 l0pd< 11PT11\1d10@-@P0 PP+P+P++U@0@-:PסP`e D@0p ႢP@ Tk`0PA-@@:ḡ`Ppd xP cP \0PU,VD0D ``QP/@p10>>0 />A-`@P\`p D0D R 0000 0>>1>0 />Mp@-0M0@0`P0 Ѝp@Ѝ/>- 0>O-pM$P@*0@ P< p\1U_`Oᕳ %"#" l/0OpW`P(0@ 0@ VPfV` +P\1P!P - Ѝ0OO$  !5;BE 0@@'P  000@n$$ 0&Ą121 113@-`p+D 0 ,@P+ 0,e- @HY@1MA-M0`@P * 0P  -` pЍAЍ/ 9MO-M80\1U_`Os p8p,,p00U0O/`v*PF 30|1\!^` 4-@ ?RD p P`00 /p 0 p00iY0^ /q,0, 0OO$[P `%%+ `/*PЍOЍ40O "!! 0IS V. ppWĄ12O-M\1U_`Osp,, P^= \1@^ P\1T `)P@x\1T p40 @4$  ʿ,Z_;  0 ~ ЍOv)0/qᒌ,0, 0OO$[P `%%+ 00OS` `&p/PǏ` 0[ -@TPĄ21@-@P 0S  vP12 \!` TX!0PATcP ^P 00 \!` TX!OP x00 \!` TX!X@P <0 \!` TX!$0$ @_T1Ą1111O-(M0@P`0P`  P`$%` P 00`C[, W "*%0:*@P* 0*+dPcP  [O Q-*@ P)`p) 0* 0*v+) 0* 0*i+[lZo[00Z0+ 0Z 0jS  CR0=0R>00l[ 0` 0[0]00 Xɟ@ @QO0S PS_(0S  Y `pXt [ / *PF0S gO0 / <*@PW) 0)@P u) 0&*+ @P!1AQ.0 +.p0y,< 0@P+< 0n,cW@R `$ 0aS0V* 00$0  V:00(ЍL !N 8 W `(0Q0*S_`b?P`)- p -( 0)( 0 0$  ᇞ`VWh W 00 0Tx`e/ ( *PwRVZ=P(A'0KP0` C[0 0[B[0C<@=P>` S@ RP S`0[]  (00(0@Tp@@@ @Y@P2222X202222<2`2 x21 38` ? 0P嗞XD/D0夝hXl X0埝tlx l0嚝 0啝0@-@i P0@_2C-pYP`P` V P `$8$&C&UXMO-`M@0Up,0 0S@ 0- ,<'b?0@1A/ M)P,@B / A)Phb0S@! ,'0@"4)P00T00S ,$~,  0ЍOЍ/RAP#PP00KU@ 0A 0$F&@$001SC ^)pQ!S_`P0PU`LQPaDHb?0@' 0 &?)DHpb?P`, W!1@0LQPa1A0p0kTia,P-00U@01@?@ 01U/ v 0!1ib@@@@x>i@|>E-@iPp`%U&# ̠00` pS @$ P0S _#PP00000@ 0%t$ $T`p,P-00>#PP0 P0 |>x>l0@-@:TP "Pp0  h0H R T0X R00@1D0 P U(0P 023>Ą1 30  x>'%A-0M 0c& &0@Pc& ' 0% 0%` 0@P(P`pP@@ PЍ@@.A>/0/>0@-(0P嵜@00@0 @0>E-M%Lp R!08A0`0s P dP`V@帛媛 000@Ѝ0堠! I&t &@PB&` ' 0x%T@P 00'P V,0@@@.A>43>>@3?03E-@P`$0 0 0 0@0  ^pp0 0,1S L`0Sp0pSp`,1S  YĄ33p@-@PT`p0 S000 0h   00C0,!R$p 0,1S )Ą43O-sP,@MP,`  P ,1SЍoP3 0S9YPB $0Sed0S^ P $0S9 P (0s3 0C S0l1S-$P),1S $ ,1S 0S ,1S l0,1S L|0S,1S (P 0SB 1 SR  PPY PB ,1SI`0SP $P 0Rl1S 0 P$1,!Ri  $v1,!R`  mPP ,1SQ  ^,1S"  {TxQ?L2TP 7P#  HP<4Ą853l44445`5P43,4 l3O-0M,@P T 8#t W# 0 0봵F00 0Sʐ Q  ($ 0P TEP (P@$0( 0S@ 0 S P R`V& Z ( @.P )pP "  0pP@L J "T (^("0(0Z ( Pkpi l1S P 0Q 3,!Rd1CSP P ("$P"Pw "u,1Sd!x3Rt GP|0SkP@  0P "P " " 'FQ 0Ѝ0S0S30h fd0( 0g 1`S 0SV (pP} P0 X    0P#PU _s(C",1SW0Sh 1Pd PN_ߘј\  z0("@(%" 0    0O0,1S("0(0%,  0w *d!0R4||| |0凘xht h0傘 (d\@X X0xĄt460 906 66|6655b 75e5`6S 7\p@-@`*0/S ]  RP S0000! 0 1 C` P pO-@M s!Tp     d<P``T6:V@0Si PP0 P 0 SPR 0:! R`@0@S  T Ub! PCS0 @&#Q V0#S 0V P 00 @0VP*0QA0 @ P:$$$#$3彗0d P 0 @ Sڂ 00Ѝ 00-R$ Q P^*0:S t2,!Rk h gY @!: ` RT R% R. (2,!RX  T Q@ 0n@ T 00 @00 @ 0i @ S@4P0SK  -|)P0S  Y000i @ @^ 00 @Q0d P 0r03 R0S  iR" R  P0 0 [  0L  D00*Sd<L7`7@7Ąh77777707p@-P@P` `[p 07p@-0@SP? p@< `P0`6 0 PVO-PMg 0S0c`p^_ [   Q%\, ^M^R \G %^hQ0   @0   @^ -LPoXp `-AA t:00 $0P0 0 K>@-PMpr `@d=` 0`p1W 0S *`WЍ 8,8@-@@-,@ 0$S00>AO-$TM 0x0 P804 P`P` 004` 5@P@P`P`@P@ P0PU $> TA 0 @D H00(0,@P@<@@P`@8 V0 3. 030Z0PU $Y 0`V $P$\ P < @T DP`0@` TЍ<@Q 0 8PU R4PU@0  0!PUO0c0 P4?\00S|Z0Po $Z$(, @_<  0< @00S Yjg    Z. 0Sb0PUs $0 /0i @< R0Q $( %. * / @0`p 0 P 0 0@P Pn00C`00V00$  0SZʦ|0nS}~X. 0XS @A$} L ``Qp #, ;@P 0@P 0H Ps % "p 0LP8 P6,1Sa L@00,08U S* 0ff?ffff>i@X8Ą8@@@@@@_0岓D PDH * 0,!R<$ O @PLo$ 0 0L O @P@PP O PQ>O0@01 $HA P h!UOyLa0P``O- M@ Tc @ i B`1`ɖPP;  0/`P PVE  0HS&p0 pcP* p- @V@U@T0H S [  X00S'[00S   @  ЍZ Y L P D 00 0)888:- 5P00 :wKA-@P`p 0PWW: 0P, O/  00(!@PP00 0P 0P!00 0@P 0@P/0ǒ00| 0@P00P 0@P<(8 $0嬒@@@0AA>?88H:P?>8@-M, 0,A$\ @wЍ@98~0@-@P0PP9PU@0 P009 9E-l!M`\00#P AO00 plVPp` 0^P 0S00S ЍEЍ`p 0BPЍEt 0ЍE< @P00 ,1@SP 0P/PĄ?,9 -L`MphP@8@@@ d- d-1 K ahPt0: S $K81SP@E 0Xʒ0 DŒፑ TP 0㺒႑ĄX9O-8M\ 0[4 4! ,R000pS 00;PP ,40 `8Ѝ 0S%0@!0 $0 00$@00@S0(0 P P Ri R  @R TA 0S>0( 0@`T+V0@T (P 0@@0,0@@P 0X0 0p R 3#1! 0$ 3 !!00PR`X`3 堠    Ů83X`ᠠ (P 0SP000"`Vv 0S P B+ `#,@P 0S }  Sz  x9g R1`21`H<2`V8ؐ`H( R  0L0S  \ X;0SD90w@,  0503 R $ t1! !p mk 00S"` "`$0!1 01厐`V Rp  R姗X0(   ({(00 0|0S @QP , 0P0S1`1`9Ą~9l99`998T:x9A-QMPM  pW00: @0  ,laF0 \0S1- 0S 0S $ l1S  0S P d1SP P0@0T0Ѝ0S3p P ,1SX 3 P000$ $Ąt 9@-Q/ %Qp Q% %Q @T PU x`0   0   @T0ׇ270C2  @U0ׇ00E70C0000 000d:d<A-0@SP* `00SP 0dp%@ 0@!2 0 Q 0nXRA 0c@ @?X?B  A-hp@T `Pᴏ %P @`TP2 RT-Q t0 -Q +Q 0P 0 -P +PP:Pd<02/T 0 2 /Tp@-PP @p0:SS /S` 0:SS /SU :S U @֏ /R 0  0 PQ/Q 7 0@ḏ0e0/  0/Sl?d<`?P-0 0崎x?X?B0@-0@SP P0S P0S P0A-pW` /00@ `PU ;00@ P`@Tߎ?00 Ap@-`P@00p0@-t 0\@P$ %\  \0000 S0S @ @-@PPP(P,P $@0@-`M@ᆎ0/ S T/S 0q/ S T/ST$  @ゎPP 0: S x0,!R/PPl`Ѝ040 /RP Ą7?p@-@`C RP ڃQQ0Q   V000p0@- R@P ڃQQ0Q  P0000 -LpP^RPO@gTa W`#0! *`0 `Q0 0P ڃQQ0Q  V! 0W:00cY>00(KP%`  0`"20    T 0 ڍ Pg00 c-aA ΍01`ឍpP@gT0.S0.S(pP@g 0%ĄA ?@X?lBE-0D $MR 0p00@ +,0S <0S80Sf`/ᾌ@P4P UPE+`/ᴌ@P 0S$@D2 R@P  0<@T 0S, @0@S0S0 P$ЍV 0/S ^ 0`PdTP (@ P@?  001S,0S 0S7 0R 0R0 S r Q /  P+: s 0Sd0 80Sh / v/ / Ą0@?TO-`PE2 R)0PfୌQ@2 ?Q@fW #QM /Qd V/:@fTpP[ /00B Ḍ0 00S SF ;SD #S@S ;S #S 0SOqOn0/S a  BV*0/S0R:0R:S0R/S0@f 0@f᫋PO@fP pp l00/QP.0/S'P l /݋% P 0p3@fS @f@f PTp  =@ P6t0  f᳋P 0/S@f @P<@O-2 M2P0 0pU (P $,P Q"  0P: : +Pϋ@ ̋0@  @@Q  R ẋ0S ᳋{ᬋ@  ы`Q ᡋ@ Ƌ PR :00唋P@ ḋP@00`[[00 ᅋP  ᪋[]00 0 @@Q :00 /E@m 000iX0  #Q (0Qk 0R0Q0S0Z _ Ѝ,0R Wg((( (0ڊ$ 0ՊT\@@@X?<Bh@G-p= @ $T/[ $0S 0 Z%$0 Y! P `  @(@/00  !000@-@P$$0@0@-@P  0@P/O-4MP2 0 RH %R7 ,90 <  RP9  0bP \ %\ 8  0 @%00," 00\0kU hh.d8,0\0   00   $8 2~`0SP0[S 0Sω@ P ^ 00:S /S@@ ;S   6 ?S$ S #S,(a PUpP PEV : fV@ Pp PpP0 ` 0  (P,pXp!P!*pP .RO WP 0/Sd PQ0U00@/:P $N  $@ R ̅0300 R@%5P 0S t ^ $m( R ,fUh  [ 4Ѝ@቉P4 0@SP000帄0 @  00  %0 0]P@ ᱹP@ XP@@[[  R`@`SP  @p0Sˈ W @0 ~:000/S PU:pR0ZS0S 0[IP3p R P R ?P #P 0S S ?S #SP㌈0@;S p  2p R P R #P 0S R #SPj0@?Sp$ 82pQ^YZ $ $00@  p@(@0@,@威0  0@P g0 00CSG 0  0 1000CS00@=0S/SP .S0S/SW GR)PpQ $0P{P61@PdpPL| |0%0&0W/S0S/S 0 BX:@ @?X?Bd<T|@@d;@d>h>@ @AB-h0S 000Sd;p@-@`P$ `~00pA-pP`PU `@PU ,U!`0@1p0 @ 00 @pPUA`0Pd<-@- Mp P@`SPP@ 0`嗇0?U  R Ѝ@Ѝ/-G-M8<@Z@ ` Pp߇U0`@PpP@Z` P`p  0`PU0 0!W@p@00ЍGЍ/-0PM0 s0D0    0$!Ѝ臇0̂B@-0PM0 s0h0    0v. @0  @Ѝb0ۂC@-@MX χp Ѝ  03(C- -`M 㗇P0: S`Ѝp@-D`P 0@P ؆`@PbpRp@-`@PUUvr / 9/ 0/ @P-9. 0/ @P!/ 0X#0@P04#0,#0@P 0#0u#0@P0"0i/0@P0/0]d 0@P0d 0Q 0@P0 0E0 00p2TUʑ ". / 0,n/ @Pi/ 0 . @P_/ 0j/ @Pe/ 0D!0@P0 !0!0@P0 0 0@Px0 0/0@Pl0/0d 0@P`0d 0 0@PT0 0 0 yʚ; TvH @B'vH Tʚ;L0TjU\0Upl \ O %p O 0 O @P O 0 O @P  O 0y O @P O 0m O @P.O 0aI/O @PN/O 0U!0@P0!0I!0@P0!0=!0@P0"01/0@P0 /0%d 0@P0 d 0 0@P0 0  0 Q @qP-0U0Lʴ TcT"T*d 00d 0 0@Pv0 0 0 /O e/O 0/O @PY9.O 0/O @PM/O 0/O @PA>.O 0/O @P5. 0p!0@P)0L!0D!0@P0 !0!0@P0 0}/0@P0/0qd 0@P0 d 0e 0@P0 0Y 0 RK $1Eἄ 000 8CrNZ~@B'@zZrN vH Tʚ;`0Th0Up0U| p O  O 0 O @P O 0 O @P O 0 O @P O 0B/O @P~G/O 0.O @PrQ/O 0V/O @Pf[/O 0n/O @PZs/O 0!0@PN0 "0("0@PB0 L"0T"0@P60 x"0/0@P*0 /0d 0@P0 d 0 0@P0 0~ 07 /O /O 0m/O @P5.O 0a/O @P/O 0U/O @P:.O 0I/O @P/O 0=/O @P?.O 01z/ @Pu/ 0%!0@P0`!0X!0@P04!0 ,!0@P0 !0/0@P0 /0d 0@P}0 d 0 0@Pq0 0 0 0a0 0 00T$Ƥ#@B'oxEcvH Tʚ;o#Ƥ~@zZrN t0T|0Uʷ D O *X O 0l O @P O 0 O @P O 0~ O @P O 0rM/O @PR/O 0fW/O @P.O 0Za/O @Pf/O 0Nk/O @P-O 0Bu/O @Pz/O 068"0@P0 \"0*d"0@P0 "0"0@P0 "0/0@P0 /0d 0@P0 d 0 0@P0 0 0\3TDd3U /O k/O 07.O @P_/O 0/O @PS/O 0-O @PG/O 0/O @P;/O 0/ @P// 0, @P#/ 0/ @P/ 0+. @P / 0w/ @P / 0 k!0@P 0 !0_!0@P 0 !0S!0@P 0 |!0G/0@P 0 /0;d 0@P 0d 0/ 0@P 0 0# 00T!/0 0/0d 0@P 0d 0 0@P 0 0 0 0Tv'?z] @B'c]xEco#Ƥ~@zZrN vH Tʚ;|0T0U  | O R O 0 O @PF O 0 O @P: O 0 O @P. B/O 0G/O @P" .O 0Q/O @P V/O 0[/O @P -O 0ve/O @P j/O 0jo/O @P .O 0^y/O @P ~/O 0 R/O @P ".O 0 F"0@P 0 "0:"0@P 0 "0."0@P 0 #0"/0@P 0/0d 0@P 0d 0  0@P 0 0  03T1#0 0#0 /0@Ps 0/0 d 0@Pg 0d 0 0@P[ 0 0  04T/ H / 0 - @P< / 0 / @P0 / 0 /. @P$ / 0 / @P / 0 *. @P / 0x / @P / 0l %. @P / 0` / @P / 0T , @P {/ 0 H / @P z/ 0 < q/ @P . 0 0 !0@P 0 `!0$ X!0@P 0 4!0 ,!0@P 0!0 /0@P 0/0 d 0@P 0d 0 0@P| 0 0  0d ]xEco#Ƥ~@zZrN vH Tʚ;?B@B'ɚ;40T?0 0J 0T 0 \ 0@P> 0 0 /0@P2 0/0 d 0@P& 0d 0 0@P 0 0  0?<1TK@!0 0d!0s l!0@P 0!0g !0@P 0!0[ /0@P 0/0O d 0@P 0d 0C 0@P 0 07  0t2TW/O  -O 0$ "0@P 0"0 "0@P 0"0 #0@P 0(#0 /0@P 0/0 d 0@P| 0d 0 0@Pp 0 0  03T =.O ] /O 0 V/ @PQ Q/ 0 0!0@PE 0 !0 !0@P9 0 0 0@P- 0 0 /0@P! 0/0 d 0@P 0d 0 0@P 0 0u 0.ꀖ@B' p-LP}00 c-!@a } .00P@/kP@Kp0@-@P`PU 00@0@@-0 @}P0T@|7A-p`@ <}0S @PP 0U0XU S@ 00@-@HQ P|P+}0 5}0 0}0t t0@*}pH P }PT|}Df}U}H,_}ĄpC7 @CHClC -L@-} `-1a}0/SPP@T/TppPpP08 TP /00P|T0P K@-`/p6}0PPg |@ }/00}@ P 0S P p3/ P 0S P 0S ?S*S [S ]S 0S//@-`\ pPW 0/S @P  |P PP p@- ``P@ 0/S@d0S P `0S  P ppĄRA-`r|@o|00Z0 R& |_|@\|00PZp 0P@ PEL0 0ZT^ 0@DRN |NL0 0Z Q0PAR@ d;p@-0PP` @PP NP V {Pp{P Pp0@-@|P0/S PXP \0S0  P#00/S A0@PXP\P  p300l@0CP 0R B/S0@\ P0 0@Ą@-@{P0.S0/S .S A@ 0/S B .S 0nL0C\ 0.S@-@PT {PH{P 0S{P HCA-RA`PRp@f d{P i{`0 0S S pGP@f P{PV`PzPWA-@-0-S8 o{`Vp< 0@0 0\  c{Q 000SڅP0PQ!W U00Q 0Sd0pwz`V@uzUW @gz@-@@0@-PP0P@ P0@@-@P`" Q 0S Pp 1SqPP1S!@ z`Pp@-`P 0S  1SP@0  p0@-@PP0 0@6x00/-M " YЍ-{@- @M@@-@mk ?PO-y0 -S ppRP 0 @00 0@>z@0 / @pP0TT` 0EE ZP @D0TT 0EE0-SE0EV  00e0 S @DPf7zC@-M  @Ѝp@-Q M5AU EUK8``V' E%$R0#V0 T 0l 0P@0P00 0z Ѝp`V@P 0 0LP z@ T*@P` Q03 P*P?$@,C7Q@-0 @@0 0 0@0@-DPD@0 0A_ $ ?C0 c 048VUUU-@0MH R Ѝ$0x yPݡĄTp@-d`@0SRyy00y`@P 0>$0Ap考@-@`ph e@PT ^ 0@P, R 0@@.AeAP-  0xyxCCDp@- M 0 0 P / Ѝpxx0PP`,00@@; 0s n0T 0 x /x@P ````xTxPPxS00ꀄ.Ad0@-MP@00 0;P 6P @ Nx0S  0 wPЍ0eA@-`QpPڠ@P0#! 002!"P 001!#V 0?0   g0U=00L 0U=00L0L00p@-P@=R  R4 @00S=R  R 0S=Rp=R !80 R0 0S=R R0 0S=R @ep=R c&40 R0 0S=R@=R @=R0@0@O-M@@ 0S`:ЍDD 0 @  T030#P0Sp^K*@ Q9* P0  w@P^@* 0 *"@ p  P 0 0 0w@@Z WP@D  /P  pwP@X%J$ w@  RP@*P@W%H$ wpP@P* -RLM@A0 a@kKp@-`M@ w`P0: S P`ЍpL0,!DR vPP vv 0&ĄCC0@-@MP 0Pw D0@-@vPP 00\D0@-@~wPP 00dDP0@-P -w@T0 0v@T 0lD0@-@9wPP 0v0tDP- Rw  0v|DDD Q,:P/ QQ11 2:QQ11 2: RP@ P@ !P!@ P@ P! R0 r P@ P@ P@ /-:Q2 aB`B QP& QQ11 2:QQ11 2: RP@ P@ !P!@ P@ P! R0 r P@ P@ P@ \`B/-@-p(% !"0@-@P41 JZtPe@0! #"0! 6U0Ơ  q&"& 0s 4d @D uΠ3R PE SΠ#RQZ|P:P:al@*rb*\ 0@D0040 R"(!0C" R"$!0C"R""!0C"R0C"0C01C S  b0 b1 @T 0@@T @@ d100 @d d10004&" @PE 41 4000ʰ#0E208Q0 0FV000/0@-K2@P0/0@-K2@Q`B `43 /23/0@-MQt /0@-P /0@-QZpK2@  ˰J    ! 0bà10@=p@-̌ J"Z 4 5o @` *VV& ÎP1`R<@D VL*P` T \^ pa @T Pt p@TX6tp@d @T @ @ Pd51!0p @d Pd41p Pd14500p4a@D 5a0 PE   4"Z 5 `` p`` 4f  5f p>pp@-̌ J"Z 4 5\ @D VK &R""#,4 R!\dUV@L* c0`VP c0ǠV`F P! ! c0V`F P!! c0V`F P!,! c0V`F P!! R&^b!.1,°T \JUV p @ Pt p@T:8"Z 4 5 4F 5 5Vm ``M@xPc{  01/p0PQQ!1/ƑƓ /  0@-PpC--3#---3# & * Z>>*S 51:3`////0@- 0@PP0@:!6p0O-Q㴥 M@P0 @PSUp`rT~TA V*V0 06@%00 sP@f)& P0 0b7C;3br&pP)p '8HRp@pE%:@bP  8#8T00E:x@d pP +8HRp@pE*RpE@@b{P  8#8R00E*R0E ȃ\L\ p ЍT*T0 06P#00 s 0b;3br& E NX%X+8HR0H@0*RH@@b - p6 8#8R00G*R0G@ȃ\"*\ࠓࠃ00<H"00 s"\ V!@rP   pV3# 01 0!#\3#010!<!00 s n627B;"~( ^p ph&h!8HR@G?:@b  p@8#8R00G(: b .Ƞ%8 8"H 8R:P00U#2P9 N6T3# 01 0!@`V*R0GRG@T0ERpE@ O-Qܥ0M@P0 @P S( U `paTT V*V0 06`%00 0s@f) 0&( 0c 0c7C;3& PuD) K'8H U@1:@e2 ;8#8U:@e# ,+8HU@*U@@e  8#8U*Ueg\(, @T# (p(,0Ѝ\w*\ࠓࠃ00<#00 sw\ V! [ pPp @T(TR*T0 06,#00 0s 0 0c;3 @ 0dt& X%X +8HX@*X@@h   8#88U0*U0e  0P@rP#p V3# 01 0!*`V*T3# 01 0!\3#010!<!00 s i61;17Ay(( $p`hx'x$@$8HRYL@>:@bG`P$ 8#8T00F':@d 8#%Ƞ ( Ȍ"!Ȭ T:00[0#02S 0[ 39@42)00 ^T0FRL@UU@T Q/6:P"# 00QQ1121:QQ1101: P@  !P@ !!P!@ #!!P@ !!P#2!//Q!! # 3 Q!! "Q!! "Q 0/-<@-@A/C- M05!P0@pU`T 0 D 0# 0" Ѝ=A *& *Z>>*SJ51:3////pD-@ o808 00aCQp`@@T:pppD-DD0D 00aCa0V:Q@@VpD@-$ 0s@B/04s--pconaddr is: %s Accepted client at socket %d. fd >= 0connect.cClosed fd %d Local socket fd %d bound. binding to address %s using port %i. Connecting to %s|%s|:%d... Connecting to %s:%d... Failed setting IPV6_V6ONLY: %s%s: unable to resolve bind address `%s'; disabling bind. connected. Created socket %d. failed: %s. fd_register_transportconnect_to_ip%d-%d Converted %d files in %.*f seconds. orig.origCannot back up %s as %s: %s %d; URL=%s?#%/index.htmlfile != ((void *)0)convert.cApparently %s has been removed. Scanning %s (from %s) will convert url %s to local %s will convert url %s to complete Converting %s... nothing to do. Cannot convert links in %s: %s Unable to delete `%s': %s wbSomething strange is going on. Please investigate.Skipping %s at position %d. ../TO_RELATIVE: %s to %s at position %d in %s. TO_COMPLETE: to %s at position %d in %s. register_redirectionpermanentsessionsecureinsecurenone Stored cookie %s %d%s %s <%s> <%s> [expiry %s] %s %s Deleted old cookie (to be replaced.) (ANY)name_b != ((void *)0) && name_e != ((void *)0)cookies.cdomainpathexpiresmax-age%lfError in Set-Cookie, field `%s'Syntax error in Set-Cookie: %s at position %d. .com.edu.net.org.gov.mil.intcdm: 1 2 3 4 5 6 7 8Cookie coming from %s attempted to set domain to %s Attempt to fake the path: %s, %s res != 0Discarded old cookie. ocnt == countpos == result_sizeCannot open cookies file `%s': %s TRUEFALSE %s %s %s %.0f %s %s Saving cookies to %s. # HTTP cookie file. # Generated by Wget on %s. # Edit at your own risk. Error writing to `%s': %s Error closing `%s': %s Done saving cookies. update_cookie_fielddiscard_matching_cookiecookie_headerbyteLength: %s (%s), %s (%s) remaining, %s remaining (unauthoritative) con->target != ((void *)0)ftp.c!((cmd & DO_LIST) && (cmd & DO_RETR))(cmd & (DO_LIST | DO_CWD | DO_RETR | DO_LOGIN)) != 0anonymous-wget@@Logging in as %s ... Error in server response, closing control connection. Error in server greeting. Write failed, closing control connection. The server refuses login. Login incorrect. Logged in! ==> SYST ... Server error, can't determine system type. done. ==> PWD ... /Initial VMS directory not in the form [...]! Preprocessing the initial VMS directory old = '%s' new = '%s' done. ==> TYPE %c ... Unknown type `%c', closing control connection. done. ==> CWD not needed. changing working directory Prepended initial PWD to relative path: pwd: '%s' old: '%s' new: '%s' *ntarget == '/'Changed file name to VMS syntax: Unix: '%s' VMS: '%s' ==> CWD %s ... No such directory `%s'. ==> CWD not required. ==> SIZE %s ... ==> PASV ... ==> EPSV ... ==> LPSV ... Cannot initiate PASV transfer. Cannot parse PASV response. trying to connect to %s port %d couldn't connect to %s port %d: %s ==> PORT ... ==> EPRT ... ==> LPRT ... socket: %s Bind error (%s). Invalid PORT. ==> REST %s ... REST failed, starting from scratch. ==> RETR %s ... No such file `%s'. ==> LIST ... No such file or directory `%s'. Lying FTP server found, adjusting. accept: %s ab%s has sprung into existence. %s: %s, closing control connection. %s (%s) - Data connection: %s; %s (%s) - Control connection closed. Data transfer aborted. File `%s' already there; not retrieving. (try:%2d)--%s-- %s %s => `%s' %s (%s) - `%s' saved [%s] %s URL: %s [%s] -> "%s" [%d] Removing file due to --delete-after in ftp_loop_internal(): Removing %s. unlink: %s .listingUsing `%s' as listing tmp file. Removed `%s'. Recursion depth %d exceeded max. depth %d. f != ((void *)0)Remote file no newer than local file `%s' -- not retrieving. Remote file is newer than local file `%s' -- retrieving. The sizes do not match (local %s) -- retrieving. Invalid name of the symlink, skipping. Already have correct symlink %s -> %s Creating symlink %s -> %s symlink: %s Skipping directory `%s'. %s: unknown/unsupported file type. %s: corrupt time-stamp. Unrecognized permissions for %s. Will not retrieve dirs since depth is %d (max %d). Rejecting `%s'. No matches on pattern `%s'. Wrote HTML-ized index to `%s' [%s]. Wrote HTML-ized index to `%s'. %s%s%s/%sComposing new CWD relative to the initial directory. odir = '%s' f->name = '%s' newdir = '%s' Not descending to `%s' as it is excluded/not-included. getftpftp_retrieve_list Detected newlines in %s "%s"; changing to %s "%s" PASS--> %s --> PASS Turtle Power! --> %s 331 s/key 331 opiekey USERaddr.type == IPV4_ADDRESSftp-basic.caddr->type == IPV4_ADDRESS%d,%d,%d,%d,%d,%dPORTaddr.type == IPV4_ADDRESS || addr.type == IPV6_ADDRESSaddr->type == IPV4_ADDRESS || addr->type == IPV6_ADDRESS%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dLPRT|%d|%s|%d|EPRTaddr != ((void *)0)port != ((void *)0)PASVLPSVlpsv addr is: %s tmpprt[0] is: %d tmpprt[1] is: %d *port is: %d af == 6ip != ((void *)0)2EPSVrespline is %s TYPECWDRESTRETRLISTSYSTVMSUNIXWINDOWS_NTWINDOWS2000MACOSOS/400PWDSIZEtype=ip_address_to_port_reprftp_portip_address_to_lprt_reprftp_lprtip_address_to_eprt_reprftp_eprtftp_pasvftp_lpsvftp_epsv ���Index of /%s on %s:%d��� 

  %d %s %02d %02d:%02d  time unknown       File        Directory   Link        Not sure    %s  (%s bytes)(nil)-> %s
JanFebMarAprMayJunJulAugSepOctNovDec:rbtotalPLAINFILE; DIRECTORY; SYMLINK; UNKNOWN; implicit perms %0o; perms %0o; month: %s; day: %d; year: %d (no tm); time: %02d:%02d:%02d (no yr); -> link to: %s .. Ignoring `.' and `..'; trailing `/' on dir. trailing `@' on link. trailing `*' on exec. Skipping. JANFEBMARAPRMAYJUNJULAUGSEPOCTNOVDECName: '%s' MYYYY/MM/DD HH:MM - %d/%02d/%02d %02d:%02d Timestamp: %ld Directory File, size %s bytes file name: '%s' .DIRFile Getting additional line empty line read, leaving listing parser confusing VMS listing item, leaving listing parser second token: '%s' day: '%s' nonsense in VMS listing, skipping this line date parsed YYYY/MM/DD HH:MM:SS - %d/%02d/%02d %02d:%02d:%02d ,confusing VMS permissions, skipping line wrong VMS permissons! permissions: %s -> 0%o Unsupported listing type, trying Unix listing parser. wrote `%s' to STORE );Ok[WQ /?!"i,9Ka~j e7 CA f!*7H}P^zKd5U_ %/^k=OG[)6FI\( QK55>n)#5Fu[maddress_list_address_ataddress_list_set_faultyaddress_list_from_addrinfoaccept_domainhost_cleanup_mapperpos >= al->faulty && pos < al->counthost.cindex == al->faultyReleasing 0x%0*lx (new refcount %d). Deleting unused 0x%0*lx. Found %s in host_name_addresses_map (%p) Resolving %s... ip - al->addresses == cntfailed: No IPv4/IPv6 addresses for host. , , ...Caching %s =>u->host != ((void *)0)al->refcount == 1convert_and_copyadvance_declarationto - (pool->contents + pool->tail) <= end - beghtml-parse.cch == '\'' || ch == 0x22ch == quote_charch == '-'hrefcodesrcbackgroundlowsrcrelhttp-equivnamecontentactionappletareabasebgsoundbodyembedfigformframeiframeimginputlayerlinkmetaobjectoverlayscripttabletd%s: no base, merge will use "%s". %s: Cannot resolve incomplete link %s. %s: link "%s" doesn't parse. %s: merge("%s", "%s") -> %s %s: merged link "%s" doesn't parse. appending "%s" to urlpos. first != -1html-url.cstylesheetshortcut iconrefreshrobotsnofollowt != ((void *)0)Loaded %s (size %s). no-follow in %s: %d %s: Invalid URL %s: %s tag_find_urlscollect_tags_mapperrequest_sendskip_short_bodypost_filegethttp%2d %s %s%.*s Registered socket %d for persistent reuse. BasicDigestWWW-AuthenticateNTLMAuthorization failed. Malformed status line(no description)LocationLast-Modifiedwget_cookie_jar != ((void *)0)Set-CookieContent-Rangebytesunspecified [following]Location: %s%s text/htmlapplication/xhtml+xml.htm.html.%d.html The file is already fully retrieved; nothing to do. Length: ignored [%s] Reusing existing connection to %s:%d. Unknown authentication scheme. HTTP/1.0 p - request_string == sizehttp.c ---request begin--- %s---request end--- Failed writing HTTP request: %s. HTTPcontlen != -1Skipping %s bytes of body: [EOF received] aborting (%s). %.*s] done. Disabling further reuse of socket %d. %a, %d %b %Y %T%A, %d-%b-%y %T%a %b %d %T %Y%a, %d-%b-%Y %T%s:%sBasic 0123456789abcdefrealmopaquenonceDigest username="%s", realm="%s", nonce="%s", uri="%s", response="%s", opaque="*hs->local_file != ((void *)0)HEADGETPOSTRefererPragmano-cachebytes=%s-Wget/%sUser-AgentAccept*/*AuthorizationProxy-Authorization[%s]Host[%s]:%dConnectionKeep-AliveContent-Typeapplication/x-www-form-urlencodedPOST data file `%s' missing: %s Content-LengthReusing fd %d. [POST data: %s] [writing POST file %s ... written == promised_sizedone] Proxy%s request sent, awaiting response... No data received. Read error (%s) in headers. ---response begin--- %s---response end--- No headers, assuming HTTP/0.9Warning: wildcards not supported in HTTP. File `%s' already there; not retrieving. Cannot write to `%s' (%s). Unable to establish SSL connection. ERROR: Redirection (%d) without location. %s: %s ERROR %d: %s. Last-modified header missing -- time-stamps turned off. Last-modified header invalid -- time-stamp ignored. Server file no newer than local file `%s' -- not retrieving. The sizes do not match (local %s) -- retrieving. Remote file is newer, retrieving. %d %s %s (%s) - `%s' saved [%s/%s] %s URL:%s [%s/%s] -> "%s" [%d] %s URL:%s [%s] -> "%s" [%d] %s (%s) - Connection closed at byte %s. %s (%s) - Read error at byte %s (%s).%s (%s) - Read error at byte %s/%s (%s). acceptaddhostdiralwaysrestbackupconvertedbackupsbindaddressconnecttimeoutcontinueconvertlinkscutdirsdebugdeleteafterdirprefixdirstructdnscachednstimeoutdotbytesdotsinlinedotspacingdotstyleexcludedirectoriesexcludedomainsfollowftpfollowtagsforcehtmlftppasswdftppasswordftpproxyftpuserglobheaderhtmlextensionhtmlifyhttpkeepalivehttppasswdhttppasswordhttpproxyhttpsproxyhttpuserignorelengthignoretagsincludedirectoriesinet4onlyinet6onlykeepsessioncookieslimitrateloadcookieslogfileloginmirrornetrcnoclobbernoparentnoproxynumtriesoutputdocumentpagerequisitespassiveftppostdatapostfilepreferfamilypreservepermissionsprogressprotocoldirectoriesproxypasswdproxypasswordproxyuserquietquotarandomwaitreadtimeoutreclevelrecursiverefererrejectrelativeonlyremovelistingrestrictfilenamesretrsymlinksretryconnrefusedsavecookiessaveheadersserverresponsespanhostsspiderstrictcommentstimestampingtriesuseproxyuseragentverbosewaitwaitretryHOME0 <= comind && comind < (sizeof (commands) / sizeof ((commands)[0]))init.cSetting %s (%s) to %s %s: Cannot read %s (%s). %s: Error in %s at line %d. %s: Syntax error in %s at line %d. %s: Unknown command `%s' in %s at line %d. no_proxy/home/elektranox/tmp/etc/wgetrcWGETRC%s: WGETRC points to %s, which doesn't exist. %s/.wgetrc%s: Warning: Both system and user wgetrc point to `%s'. val != ((void *)0)%s: Invalid --execute command `%s' %s: %s: Invalid boolean `%s'; use `on' or `off'. alwaysnever%s: %s: Invalid extended boolean `%s'; use one of `on', `off', `always', or `never'. %s: %s: Invalid number `%s'. inf%s: %s: Invalid byte value `%s' %s: %s: Invalid time period `%s' %s: %s: Invalid header `%s'. IPv4IPv6%s: %s: Invalid value `%s'. %s: %s: Invalid progress type `%s'. unixwindowsnocontrol%s: %s: Invalid restriction `%s', use `unix' or `windows'. setval_internalsetoptval   %s: %s: %s base == 8 || base == 16log.c0123456789ABCDEFwget-log %s received, redirecting output to `%s'. %s received. %s: %s; disabling logging. escnonprint_internalappend-outputbackup-convertedbind-addresscacertificatecadirectorycertificatecertificatetypecheckcertificateclobberconnect-timeoutconvert-linkscut-dirsdelete-afterdirectory-prefixdns-cachedns-timeoutdont-remove-listingdot-styleegd-fileegdfileexclude-directoriesexclude-domainsexecutefollow-ftpfollow-tagsforce-directoriesforce-htmlftp-passwordftp-userhelphost-directorieshtml-extensionhttp-keep-alivehttp-passwdhttp-passwordhttp-userignore-lengthignore-tagsinclude-directoriesinet4-onlyinet6-onlyinput-filekeep-session-cookieslevellimit-rateload-cookiesnono-clobberno-parentoutput-documentoutput-filepage-requisitesparentpassive-ftppost-datapost-fileprefer-familypreserve-permissionsprivatekeyprivatekeytypeprotocol-directoriesproxy__compatproxy-passwdproxy-passwordproxy-userrandom-filerandomfilerandom-waitread-timeoutrelativeremove-listingrestrict-file-namesretr-symlinksretry-connrefusedsave-cookiessave-headerssecureprotocolserver-responsespan-hostsstrict-commentsuser-agentversionUsage: %s [OPTION]... [URL]... Mandatory arguments to long options are mandatory for short options too. Startup: -V, --version display the version of Wget and exit. -h, --help print this help. -b, --background go to background after startup. -e, --execute=COMMAND execute a `.wgetrc'-style command. Logging and input file: -o, --output-file=FILE log messages to FILE. -a, --append-output=FILE append messages to FILE. -d, --debug print lots of debugging information. -q, --quiet quiet (no output). -v, --verbose be verbose (this is the default). -nv, --no-verbose turn off verboseness, without being quiet. -i, --input-file=FILE download URLs found in FILE. -F, --force-html treat input file as HTML. -B, --base=URL prepends URL to relative links in -F -i file. Download: -t, --tries=NUMBER set number of retries to NUMBER (0 unlimits). --retry-connrefused retry even if connection is refused. -O, --output-document=FILE write documents to FILE. -nc, --no-clobber skip downloads that would download to existing files. -c, --continue resume getting a partially-downloaded file. --progress=TYPE select progress gauge type. -N, --timestamping don't re-retrieve files unless newer than local. -S, --server-response print server response. --spider don't download anything. -T, --timeout=SECONDS set all timeout values to SECONDS. --dns-timeout=SECS set the DNS lookup timeout to SECS. --connect-timeout=SECS set the connect timeout to SECS. --read-timeout=SECS set the read timeout to SECS. -w, --wait=SECONDS wait SECONDS between retrievals. --waitretry=SECONDS wait 1..SECONDS between retries of a retrieval. --random-wait wait from 0...2*WAIT secs between retrievals. -Y, --proxy explicitly turn on proxy. --no-proxy explicitly turn off proxy. -Q, --quota=NUMBER set retrieval quota to NUMBER. --bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host. --limit-rate=RATE limit download rate to RATE. --no-dns-cache disable caching DNS lookups. --restrict-file-names=OS restrict chars in file names to ones OS allows. -4, --inet4-only connect only to IPv4 addresses. -6, --inet6-only connect only to IPv6 addresses. --prefer-family=FAMILY connect first to addresses of specified family, one of IPv6, IPv4, or none. --user=USER set both ftp and http user to USER. --password=PASS set both ftp and http password to PASS. Directories: -nd, --no-directories don't create directories. -x, --force-directories force creation of directories. -nH, --no-host-directories don't create host directories. --protocol-directories use protocol name in directories. -P, --directory-prefix=PREFIX save files to PREFIX/... --cut-dirs=NUMBER ignore NUMBER remote directory components. HTTP options: --http-user=USER set http user to USER. --http-password=PASS set http password to PASS. --no-cache disallow server-cached data. -E, --html-extension save HTML documents with `.html' extension. --ignore-length ignore `Content-Length' header field. --header=STRING insert STRING among the headers. --proxy-user=USER set USER as proxy username. --proxy-password=PASS set PASS as proxy password. --referer=URL include `Referer: URL' header in HTTP request. --save-headers save the HTTP headers to file. -U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION. --no-http-keep-alive disable HTTP keep-alive (persistent connections). --no-cookies don't use cookies. --load-cookies=FILE load cookies from FILE before session. --save-cookies=FILE save cookies to FILE after session. --keep-session-cookies load and save session (non-permanent) cookies. --post-data=STRING use the POST method; send STRING as the data. --post-file=FILE use the POST method; send contents of FILE. FTP options: --ftp-user=USER set ftp user to USER. --ftp-password=PASS set ftp password to PASS. --no-remove-listing don't remove `.listing' files. --no-glob turn off FTP file name globbing. --no-passive-ftp disable the "passive" transfer mode. --retr-symlinks when recursing, get linked-to files (not dir). --preserve-permissions preserve remote file permissions. Recursive download: -r, --recursive specify recursive download. -l, --level=NUMBER maximum recursion depth (inf or 0 for infinite). --delete-after delete files locally after downloading them. -k, --convert-links make links in downloaded HTML point to local files. -K, --backup-converted before converting file X, back up as X.orig. -m, --mirror shortcut for -N -r -l inf --no-remove-listing. -p, --page-requisites get all images, etc. needed to display HTML page. --strict-comments turn on strict (SGML) handling of HTML comments. Recursive accept/reject: -A, --accept=LIST comma-separated list of accepted extensions. -R, --reject=LIST comma-separated list of rejected extensions. -D, --domains=LIST comma-separated list of accepted domains. --exclude-domains=LIST comma-separated list of rejected domains. --follow-ftp follow FTP links from HTML documents. --follow-tags=LIST comma-separated list of followed HTML tags. --ignore-tags=LIST comma-separated list of ignored HTML tags. -H, --span-hosts go to foreign hosts when recursive. -L, --relative follow relative links only. -I, --include-directories=LIST list of allowed directories. -X, --exclude-directories=LIST list of excluded directories. -np, --no-parent don't ascend to the parent directory. Mail bug reports and suggestions to . GNU Wget %s, a non-interactive network retriever. GNU Wget %s Copyright (C) 2005 Free Software Foundation, Inc. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. Originally written by Hrvoje Niksic . opt->argtype != -1main.co <= (sizeof (long_options) / sizeof ((long_options)[0]))Try `%s --help' for more options. %s: illegal option -- `-n%c' Can't be verbose and quiet at the same time.Can't timestamp and not clobber old files at the same time.Cannot specify both --inet4-only and --inet6-only.%s: missing URL DEBUG output created by Wget %s on %s. linux-gnuRemoving file due to --delete-after in main(): No URLs found in %s. FINISHED --%s-- Downloaded: %s bytes in %d files Download quota (%s bytes) EXCEEDED! SIGHUPSIGUSR1WTF?!init_switches.netrcmacdefaccount%s: %s:%d: warning: "%s" token appears before any machine name defaultmachine%s: %s:%d: unknown token "%s" %5ldKdp->dots < opt.dots_in_lineprogress.cdotbar %*s[ skipping %dK ]%3d%%binarymegagigaInvalid dot style specification `%s'; leaving unchanged. B/sM/sG/spercentage <= 100%2d%% 100%dlsz <= progress_sizeinsz <= dlsz %-11s %7.2f%s --.--K/s ETA %02d:%02d ETA %d:%02d:%02d p - bp->buffer <= bp->width TERMforceemacsdot_createcreate_imageCannot get REALTIME clock frequency: %s Not following %s because robots.txt forbids it. Decided to load it. Decided NOT to load it. Enqueuing %s at depth %d Queue count %d, maxcount %d. Dequeuing %s at depth %d Deciding whether to enqueue "%s". Already on the black list. Not following non-HTTP schemes. It doesn't really look like a relative link. The domain was not accepted. Going to "%s" would escape "%s" with no_parent on. %s (%s) is excluded/not-included. %s (%s) does not match acc/rej rules. This is not the same hostname as the parent's (%s and %s). Already downloaded "%s", reusing it from "%s". orig_parsed != ((void *)0)recur.cnew_parsed != ((void *)0)Redirection "%s" failed the test. Not descending further; at depth %d, max. %d. url_parsed != ((void *)0)--delete-afterrecursive rejection criteriaRemoving file due to %s in recursive_retrieve(): Removing %s since it should be rejected. descend_redirect_pretrieve_treeprune_non_exactres_parse!((p) >= lineend)res.cIgnoring malformed line %dwgetallowdisallowIgnoring unknown field at line %dj == cntCannot open %s: %sAllowingRejecting%s path %s because of rule `%s'. /robots.txtLoading robots.txt; please ignore errors. deferring a %.2f ms sleep (%s/%.2f). sleeping %.2f ms for %s bytes, adjust %.2f ms maxsize >= bufsizeretr.cmsecs >= 0bytes >= 0KB/sMB/sGB/s%7.2f %s%.2f %sGiving up. Retrying. sleep_between_retrievals: avg=%f,sleep=%f %s.%dhttp_proxyftp_proxyError parsing proxy URL %s: %s. Error in proxy URL %s: Must be HTTP. mynewloc != ((void *)0)%d redirections exceeded. Removing file due to --delete-after in retrieve_from_file(): fd_read_hunkcalc_rateretrieve_url  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~CBBBBQ00000000000000000000000000000000;?#?#httphttp://ftp://No errorUnsupported schemeInvalid host nameBad port numberInvalid user nameUnterminated IPv6 numeric addressIPv6 addresses not supportedInvalid IPv6 numeric addressp2 - newstr == newlenurl.cftp://%shttp://%serror_code >= 0 && error_code < (sizeof (parse_errors) / sizeof ((parse_errors)[0]))Removing %s because of directory danger! %2E%2Eq - ((dest)->base + (dest)->tail) == outlenindex.html?;#scheme_str != ((void *)0)*password*p - result == size@/?#;:/;?#/;?#*p == 0url_escape_1url_errorappend_uri_pathelurl_stringreencode_escapesurl_parse%02d:%02d:%02d%04d-%02d-%02d %02d:%02d:%02dutime(%s): %s %lldforkContinuing in background, pid %d. Output will be written to `%s'. /dev/nullhtm%.*f%csig == 14utils.cUnlinking %s (symlink). Failed to unlink symlink `%s': %s abort_run_with_timeout1.10.2%s: %s: Failed to allocate %ld bytes; memory exhausted. malloccallocreallocstrdupptr != ((void *)0)xmalloc.cchecking_free/U (Ȍ   PoLooHȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖȖD@HPX`hp0< $(,048<@AABEACEACTADADAADDAGOAIDAIMAIRALLALPAMAMYANANAANDANNANTANYAPEAPSAPTARCAREARKARMARTASASHASKATATEAUGAUKAVEAWEAWKAWLAWNAXAYEBADBAGBAHBAMBANBARBATBAYBEBEDBEEBEGBENBETBEYBIBBIDBIGBINBITBOBBOGBONBOOBOPBOWBOYBUBBUDBUGBUMBUNBUSBUTBUYBYBYECABCALCAMCANCAPCARCATCAWCODCOGCOLCONCOOCOPCOTCOWCOYCRYCUBCUECUPCURCUTDABDADDAMDANDARDAYDEEDELDENDESDEWDIDDIEDIGDINDIPDODOEDOGDONDOTDOWDRYDUBDUDDUEDUGDUNEAREATEDEELEGGEGOELIELKELMELYEMENDESTETCEVAEVEEWEEYEFADFANFARFATFAYFEDFEEFEWFIBFIGFINFIRFITFLOFLYFOEFOGFORFRYFUMFUNFURGABGADGAGGALGAMGAPGASGAYGEEGELGEMGETGIGGILGINGOGOTGUMGUNGUSGUTGUYGYMGYPHAHADHALHAMHANHAPHASHATHAWHAYHEHEMHENHERHEWHEYHIHIDHIMHIPHISHITHOHOBHOCHOEHOGHOPHOTHOWHUBHUEHUGHUHHUMHUTIICYIDAIFIKEILLINKINNIOIONIQIRAIREIRKISITITSIVYJABJAGJAMJANJARJAWJAYJETJIGJIMJOJOBJOEJOGJOTJOYJUGJUTKAYKEGKENKEYKIDKIMKINKITLALABLACLADLAGLAMLAPLAWLAYLEALEDLEELEGLENLEOLETLEWLIDLIELINLIPLITLOLOBLOGLOPLOSLOTLOULOWLOYLUGLYEMAMACMADMAEMANMAOMAPMATMAWMAYMEMEGMELMENMETMEWMIDMINMITMOBMODMOEMOOMOPMOSMOTMOWMUDMUGMUMMYNABNAGNANNAPNATNAYNENEDNEENETNEWNIBNILNIPNITNONOBNODNONNORNOTNOVNOWNUNUNNUTOOAFOAKOAROATODDODEOFOFFOFTOHOILOKOLDONONEORORBOREORROSOTTOUROUTOVAOWOWEOWLOWNOXPAPADPALPAMPANPAPPARPATPAWPAYPEAPEGPENPEPPERPETPEWPHIPIPIEPINPITPLYPOPODPOEPOPPOTPOWPROPRYPUBPUGPUNPUPPUTQUORAGRAMRANRAPRATRAWRAYREBREDREPRETRIBRIDRIGRIMRIORIPROBRODROERONROTROWROYRUBRUERUGRUMRUNRYESACSADSAGSALSAMSANSAPSATSAWSAYSEASECSEESENSETSEWSHESHYSINSIPSIRSISSITSKISKYSLYSOSOBSODSONSOPSOWSOYSPASPYSUBSUDSUESUMSUNSUPTABTADTAGTANTAPTARTEATEDTEETENTHETHYTICTIETIMTINTIPTOTOETOGTOMTONTOOTOPTOWTOYTRYTUBTUGTUMTUNTWOUNUPUSUSEVANVATVETVIEWADWAGWARWASWAYWEWEBWEDWEEWETWHOWHYWINWITWOKWONWOOWOWWRYWUYAMYAPYAWYEYEAYESYETYOUABEDABELABETABLEABUTACHEACIDACMEACREACTAACTSADAMADDSADENAFARAFROAGEEAHEMAHOYAIDAAIDEAIDSAIRYAJARAKINALANALECALGAALIAALLYALMAALOEALSOALTOALUMALVAAMENAMESAMIDAMMOAMOKAMOSAMRAANDYANEWANNAANNEANTEANTIAQUAARABARCHAREAARGOARIDARMYARTSARTYASIAASKSATOMAUNTAURAAUTOAVERAVIDAVISAVONAVOWAWAYAWRYBABEBABYBACHBACKBADEBAILBAITBAKEBALDBALEBALIBALKBALLBALMBANDBANEBANGBANKBARBBARDBAREBARKBARNBARRBASEBASHBASKBASSBATEBATHBAWDBAWLBEADBEAKBEAMBEANBEARBEATBEAUBECKBEEFBEENBEERBEETBELABELLBELTBENDBENTBERGBERNBERTBESSBESTBETABETHBHOYBIASBIDEBIENBILEBILKBILLBINDBINGBIRDBITEBITSBLABBLATBLEDBLEWBLOBBLOCBLOTBLOWBLUEBLUMBLURBOARBOATBOCABOCKBODEBODYBOGYBOHRBOILBOLDBOLOBOLTBOMBBONABONDBONEBONGBONNBONYBOOKBOOMBOONBOOTBOREBORGBORNBOSEBOSSBOTHBOUTBOWLBOYDBRADBRAEBRAGBRANBRAYBREDBREWBRIGBRIMBROWBUCKBUDDBUFFBULBBULKBULLBUNKBUNTBUOYBURGBURLBURNBURRBURTBURYBUSHBUSSBUSTBUSYBYTECADYCAFECAGECAINCAKECALFCALLCALMCAMECANECANTCARDCARECARLCARRCARTCASECASHCASKCASTCAVECEILCELLCENTCERNCHADCHARCHATCHAWCHEFCHENCHEWCHICCHINCHOUCHOWCHUBCHUGCHUMCITECITYCLADCLAMCLANCLAWCLAYCLODCLOGCLOTCLUBCLUECOALCOATCOCACOCKCOCOCODACODECODYCOEDCOILCOINCOKECOLACOLDCOLTCOMACOMBCOMECOOKCOOLCOONCOOTCORDCORECORKCORNCOSTCOVECOWLCRABCRAGCRAMCRAYCREWCRIBCROWCRUDCUBACUBECUFFCULLCULTCUNYCURBCURDCURECURLCURTCUTSDADEDALEDAMEDANADANEDANGDANKDAREDARKDARNDARTDASHDATADATEDAVEDAVYDAWNDAYSDEADDEAFDEALDEANDEARDEBTDECKDEEDDEEMDEERDEFTDEFYDELLDENTDENYDESKDIALDICEDIEDDIETDIMEDINEDINGDINTDIREDIRTDISCDISHDISKDIVEDOCKDOESDOLEDOLLDOLTDOMEDONEDOOMDOORDORADOSEDOTEDOUGDOURDOVEDOWNDRABDRAGDRAMDRAWDREWDRUBDRUGDRUMDUALDUCKDUCTDUELDUETDUKEDULLDUMBDUNEDUNKDUSKDUSTDUTYEACHEARLEARNEASEEASTEASYEBENECHOEDDYEDENEDGEEDGYEDITEDNAEGANELANELBAELLAELSEEMILEMITEMMAENDSERICEROSEVENEVEREVILEYEDFACEFACTFADEFAILFAINFAIRFAKEFALLFAMEFANGFARMFASTFATEFAWNFEARFEATFEEDFEELFEETFELLFELTFENDFERNFESTFEUDFIEFFIGSFILEFILLFILMFINDFINEFINKFIREFIRMFISHFISKFISTFITSFIVEFLAGFLAKFLAMFLATFLAWFLEAFLEDFLEWFLITFLOCFLOGFLOWFLUBFLUEFOALFOAMFOGYFOILFOLDFOLKFONDFONTFOODFOOLFOOTFORDFOREFORKFORMFORTFOSSFOULFOURFOWLFRAUFRAYFREDFREEFRETFREYFROGFROMFUELFULLFUMEFUNDFUNKFURYFUSEFUSSGAFFGAGEGAILGAINGAITGALAGALEGALLGALTGAMEGANGGARBGARYGASHGATEGAULGAURGAVEGAWKGEARGELDGENEGENTGERMGETSGIBEGIFTGILDGILLGILTGINAGIRDGIRLGISTGIVEGLADGLEEGLENGLIBGLOBGLOMGLOWGLUEGLUMGLUTGOADGOALGOATGOERGOESGOLDGOLFGONEGONGGOODGOOFGOREGORYGOSHGOUTGOWNGRABGRADGRAYGREGGREWGREYGRIDGRIMGRINGRITGROWGRUBGULFGULLGUNKGURUGUSHGUSTGWENGWYNHAAGHAASHACKHAILHAIRHALEHALFHALLHALOHALTHANDHANGHANKHANSHARDHARKHARMHARTHASHHASTHATEHATHHAULHAVEHAWKHAYSHEADHEALHEARHEATHEBEHECKHEEDHEELHEFTHELDHELLHELMHERBHERDHEREHEROHERSHESSHEWNHICKHIDEHIGHHIKEHILLHILTHINDHINTHIREHISSHIVEHOBOHOCKHOFFHOLDHOLEHOLMHOLTHOMEHONEHONKHOODHOOFHOOKHOOTHORNHOSEHOSTHOURHOVEHOWEHOWLHOYTHUCKHUEDHUFFHUGEHUGHHUGOHULKHULLHUNKHUNTHURDHURLHURTHUSHHYDEHYMNIBISICONIDEAIDLEIFFYINCAINCHINTOIONSIOTAIOWAIRISIRMAIRONISLEITCHITEMIVANJACKJADEJAILJAKEJANEJAVAJEANJEFFJERKJESSJESTJIBEJILLJILTJIVEJOANJOBSJOCKJOELJOEYJOHNJOINJOKEJOLTJOVEJUDDJUDEJUDOJUDYJUJUJUKEJULYJUNEJUNKJUNOJURYJUSTJUTEKAHNKALEKANEKANTKARLKATEKEELKEENKENOKENTKERNKERRKEYSKICKKILLKINDKINGKIRKKISSKITEKLANKNEEKNEWKNITKNOBKNOTKNOWKOCHKONGKUDOKURDKURTKYLELACELACKLACYLADYLAIDLAINLAIRLAKELAMBLAMELANDLANELANGLARDLARKLASSLASTLATELAUDLAVALAWNLAWSLAYSLEADLEAFLEAKLEANLEARLEEKLEERLEFTLENDLENSLENTLEONLESKLESSLESTLETSLIARLICELICKLIEDLIENLIESLIEULIFELIFTLIKELILALILTLILYLIMALIMBLIMELINDLINELINKLINTLIONLISALISTLIVELOADLOAFLOAMLOANLOCKLOFTLOGELOISLOLALONELONGLOOKLOONLOOTLORDLORELOSELOSSLOSTLOUDLOVELOWELUCKLUCYLUGELUKELULULUNDLUNGLURALURELURKLUSHLUSTLYLELYNNLYONLYRAMACEMADEMAGIMAIDMAILMAINMAKEMALEMALIMALLMALTMANAMANNMANYMARCMAREMARKMARSMARTMARYMASHMASKMASSMASTMATEMATHMAULMAYOMEADMEALMEANMEATMEEKMEETMELDMELTMEMOMENDMENUMERTMESHMESSMICEMIKEMILDMILEMILKMILLMILTMIMIMINDMINEMINIMINKMINTMIREMISSMISTMITEMITTMOANMOATMOCKMODEMOLDMOLEMOLLMOLTMONAMONKMONTMOODMOONMOORMOOTMOREMORNMORTMOSSMOSTMOTHMOVEMUCHMUCKMUDDMUFFMULEMULLMURKMUSHMUSTMUTEMUTTMYRAMYTHNAGYNAILNAIRNAMENARYNASHNAVENAVYNEALNEARNEATNECKNEEDNEILNELLNEONNERONESSNESTNEWSNEWTNIBSNICENICKNILENINANINENOAHNODENOELNOLLNONENOOKNOONNORMNOSENOTENOUNNOVANUDENULLNUMBOATHOBEYOBOEODINOHIOOILYOINTOKAYOLAFOLDYOLGAOLINOMANOMENOMITONCEONESONLYONTOONUSORALORGYOSLOOTISOTTOOUCHOUSTOUTSOVALOVENOVEROWLYOWNSQUADQUITQUODRACERACKRACYRAFTRAGERAIDRAILRAINRAKERANKRANTRARERASHRATERAVERAYSREADREALREAMREARRECKREEDREEFREEKREELREIDREINRENARENDRENTRESTRICERICHRICKRIDERIFTRILLRIMERINGRINKRISERISKRITEROADROAMROARROBEROCKRODEROILROLLROMEROODROOFROOKROOMROOTROSAROSEROSSROSYROTHROUTROVEROWEROWSRUBERUBYRUDERUDYRUINRULERUNGRUNSRUNTRUSERUSHRUSKRUSSRUSTRUTHSACKSAFESAGESAIDSAILSALESALKSALTSAMESANDSANESANGSANKSARASAULSAVESAYSSCANSCARSCATSCOTSEALSEAMSEARSEATSEEDSEEKSEEMSEENSEESSELFSELLSENDSENTSETSSEWNSHAGSHAMSHAWSHAYSHEDSHIMSHINSHODSHOESHOTSHOWSHUNSHUTSICKSIDESIFTSIGHSIGNSILKSILLSILOSILTSINESINGSINKSIRESITESITSSITUSKATSKEWSKIDSKIMSKINSKITSLABSLAMSLATSLAYSLEDSLEWSLIDSLIMSLITSLOBSLOGSLOTSLOWSLUGSLUMSLURSMOGSMUGSNAGSNOBSNOWSNUBSNUGSOAKSOARSOCKSODASOFASOFTSOILSOLDSOMESONGSOONSOOTSORESORTSOULSOURSOWNSTABSTAGSTANSTARSTAYSTEMSTEWSTIRSTOWSTUBSTUNSUCHSUDSSUITSULKSUMSSUNGSUNKSURESURFSWABSWAGSWAMSWANSWATSWAYSWIMSWUMTACKTACTTAILTAKETALETALKTALLTANKTASKTATETAUTTEALTEAMTEARTECHTEEMTEENTEETTELLTENDTENTTERMTERNTESSTESTTHANTHATTHEETHEMTHENTHEYTHINTHISTHUDTHUGTICKTIDETIDYTIEDTIERTILETILLTILTTIMETINATINETINTTINYTIRETOADTOGOTOILTOLDTOLLTONETONGTONYTOOKTOOLTOOTTORETORNTOTETOURTOUTTOWNTRAGTRAMTRAYTREETREKTRIGTRIMTRIOTRODTROTTROYTRUETUBATUBETUCKTUFTTUNATUNETUNGTURFTURNTUSKTWIGTWINTWITULANUNITURGEUSEDUSERUSESUTAHVAILVAINVALEVARYVASEVASTVEALVEDAVEILVEINVENDVENTVERBVERYVETOVICEVIEWVINEVISEVOIDVOLTVOTEWACKWADEWAGEWAILWAITWAKEWALEWALKWALLWALTWANDWANEWANGWANTWARDWARMWARNWARTWASHWASTWATSWATTWAVEWAVYWAYSWEAKWEALWEANWEARWEEDWEEKWEIRWELDWELLWELTWENTWEREWERTWESTWHAMWHATWHEEWHENWHETWHOAWHOMWICKWIFEWILDWILLWINDWINEWINGWINKWINOWIREWISEWISHWITHWOLFWONTWOODWOOLWORDWOREWORKWORMWORNWOVEWRITWYNNYALEYANGYANKYARDYARNYAWLYAWNYEAHYEARYELLYOGAYOKE ( 04 00 0 0  @ 0 0 000444HLX`h(wpwxw\ywwwwy w w w w wLzzwwwww w(8l$t |0T04Ԅ00,,d44d0@$PT0\0@80l,t0|(0T40$l,< ,$,d$D0 @08$00\d<\dHdTXd\d0dl,0|x0pdpdddld؄0<(D`0d0D00ԅ<<<H PXdX``0h0t0̄H00h\dPdHdL\\00d(d8dDȄ0L܅T0`$lxhd 0 0D0Є0Ѕ0@000 0(X080H̄P|0Ld\hĄ0p$xȅ$A, a4b4< K,,BP 4` p |     @PcP k\@@ ltdt |X PlDl0<HPXdte| xF$<T\\ddh\El|| (4DPId4p6|ill0<XmXnhtOoHp  ,8H`l|p9PYP((8DqDLQLT`xrxRL 4DXhxSH  (T8N8HtHU\hvhhhVpwpxxl4@l0L0p0l| \(hT(hPd8|Pl4x@l T   ,!h!!!4"""#P###4$l$$$%D%%% &ld&|&&'T'''@((l((P)))D***0+x+++@,l,+1 1&"(" '022428202888l>t>P|>>>>>>>? ?KMGTPEABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/>?456789:;<=  !"#$%&'()*+,-./0123DGCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2GCC: (GNU) 4.0.2X8,~ 4&HLqp(\'T$LĖzX../sysdeps/arm/elf/start.S/home/elektranox/Desktop/gp2xdev/toolchain/glibc-2.3.5/csuGNU AS 2.16.1R/home/elektranox/Desktop/gp2xdev/toolchain/glibc-2.3.5/build-gp2x/csu/crti.S/home/elektranox/Desktop/gp2xdev/toolchain/glibc-2.3.5/csuGNU AS 2.16.1$H../../gcc/config/arm/lib1funcs.asm/home/elektranox/Desktop/gp2xdev/toolchain/gcc-4.0.2/build-gp2x-c++/gccGNU AS 2.16.18Y../../gcc/config/arm/lib1funcs.asm/home/elektranox/Desktop/gp2xdev/toolchain/gcc-4.0.2/build-gp2x-c++/gccGNU AS 2.16.1L../../gcc/config/arm/lib1funcs.asm/home/elektranox/Desktop/gp2xdev/toolchain/gcc-4.0.2/build-gp2x-c++/gccGNU AS 2.16.1`#../../gcc/config/arm/ieee754-df.S/home/elektranox/Desktop/gp2xdev/toolchain/gcc-4.0.2/build-gp2x-c++/gccGNU AS 2.16.1t../../gcc/config/arm/ieee754-df.S/home/elektranox/Desktop/gp2xdev/toolchain/gcc-4.0.2/build-gp2x-c++/gccGNU AS 2.16.1../../gcc/config/arm/ieee754-df.S/home/elektranox/Desktop/gp2xdev/toolchain/gcc-4.0.2/build-gp2x-c++/gccGNU AS 2.16.1../../gcc/config/arm/ieee754-df.S/home/elektranox/Desktop/gp2xdev/toolchain/gcc-4.0.2/build-gp2x-c++/gccGNU AS 2.16.1-$../../gcc/config/arm/lib1funcs.asm/home/elektranox/Desktop/gp2xdev/toolchain/gcc-4.0.2/build-gp2x-c++/gccGNU AS 2.16.1../../gcc/config/arm/ieee754-df.S/home/elektranox/Desktop/gp2xdev/toolchain/gcc-4.0.2/build-gp2x-c++/gccGNU AS 2.16.1 /home/elektranox/Desktop/gp2xdev/toolchain/glibc-2.3.5/build-gp2x/csu/crtn.S/home/elektranox/Desktop/gp2xdev/toolchain/glibc-2.3.5/csuGNU AS 2.16.1%%%%%%%%%%%%N. ../sysdeps/arm/elfstart.SX..,...,.0.` /home/elektranox/Desktop/gp2xdev/toolchain/glibc-2.3.5/build-gp2x/csucrti.S 7(, ,,-,-,,,-,a6 ../../gcc/config/armlib1funcs.asmH,,,,,,}+N/{cg6 ../../gcc/config/armlib1funcs.asm,,,,,,,,,,|+N,,/yc[6 ../../gcc/config/armlib1funcs.asm,,y++,y+F ../../gcc/config/armieee754-df.Slib1funcs.asm,03.,,,,,,,,/,,,,,,,,,,02(,,,,,,-,,,,,/,/.,,,,,,,,,,,,,,/,,,,/,,,.,,,.,,2,,,,++,,,,,2,,,,,,,,,,,,,,,,,,+,,,/,,,,/,,,,.,,~++,,,,.,,,,~++,,,,~++,~++,,,,,/,,-,,.,,~++.,~++,,,,~++,~++/,,~++,,,,,,,,,~++,,,,,,--,3,,,,,,,--,3,,,,,,,-,,.,,,,3/ +.,0/ +.,,,-,/,,.,.,,,,,-,,,,,,F ../../gcc/config/armieee754-df.Slib1funcs.asm.,,,,,,../,,,,,,+,,,,,,1,.,,,,,,.,,,,.,,.,,,{++,,,,,,{++,,/.,,{++,,,,.,,,,,,,,,,{++,,,,,,,,,{++,,,,,,,,,{++,,,,,,,,,,,,,,,,,,/,,,.,,/,,z++,,,,,,,,,,,,,,//,,,z++,z++.,,,,,,../,,,,,,,,,,./,,,,,,.,,,,,.,,,,,,,,,,,,,,,,,,,,,,,,,-,,,,,,,,,/,,,,,.,,.,,.,,,,y++,,,,y++,,,0,/,,,,,,,,,,,,,,,,,,,-,,-,,,,F ../../gcc/config/armieee754-df.Slib1funcs.asm,/,0-.,,,,/,,,,,...,.,,,.,,,,,,,,,,, +,,,,,,2,-.x++,,,x++,,,x++,,,x++,,,x++,,,w+a5 ../../gcc/config/armieee754-df.S ,,,,,,.,,,,,,-,-,,,,-,x6 ../../gcc/config/armlib1funcs.asm,,,,,,}+>,-,,}+,/{c+,,,,,_5 ../../gcc/config/armieee754-df.S ,,,,,,,.,,,,-,-,,,-,` /home/elektranox/Desktop/gp2xdev/toolchain/glibc-2.3.5/build-gp2x/csucrtn.SĖ.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.dynamic.got.data.bss.comment.debug_aranges.debug_info.debug_abbrev.debug_line# 1((7 ?Ȍ GoHHToLLpc Pl   upȖ{XX<  Y YlE\4pdL  \ s1(ȌHL   Ȗ X  E Y i l i i  oliX ll zlllElĜ iĜ l, < i< i D l ' i i 8ERE`l i l  i i iĖ i  i h$   l i l i l i  l iġ 9tlԢ R\`Xi l | i l  l$i l0 (,iD lp 04i ļ i l i l 8P$T0i$ ll i Ii l4 i S\  ll ehu| i| T lԲ زh iز l8 @L i@ l  i l i l li̶ lt i l i  lX i\ l d) 8l@HP`i l i l i l i l i  Xi b m( l ~p D i  P  ll @P i l 4 i l@ i` l   i l 4 i 8 #T<ll X i k4   ll i l   i l i l, \H i\ l  i l  i l  i lX i lx i$ l8 i l i0 XL #< 0l ld i4 l  iL l\ B[tfp ip l i x4 l    i  l i l i l i4 ll | i| l< li\ lt  i l   i0 l '@ i l< Y  i` l4  r, iX  l% 8 i@% l& i0' l' i' l( i( lT) i\) l* i* l* i* l<, i`, lD- iP- lD. iL. l. .| i. 0ll3  04x  i4 l> <0i> l> i> lB i0C l8J l J` iJ lK xiK lN l$Nd iN l iTa l$b V i(b lb o  bL ib lb ib l,c  | 4cL i4c ldj j` ij ll il lm idn lPu  lll h- |8 wt F \y V yT f Lz v z` xup ixu u lw iw lHy i\y ly iy lHz iLz lz iz l8}  \}` i\} l} i} l i@ lT ih l  D i   lx "  ; | i| l H d i U x lD n H` iH l ( i Љx H,  t l ,x i, l ( < @ i  ll $  i l @ L i l J W $b n y  i l   (   # i l @i l0 ih l i l i l iػ l0 Dz l L  0T  , ' d, 2 $0 ; l I TD \ <t f D { 0 0  d H  \  t h@ #, @H Q dX i l i lD tHp iH l <  i l< X iX l i l Hi l L  i l i l$ i0 lt i l i, l  i l` id l i  l d i l| i l i< l i l i$ lp i l  iT l i l i l i lX X lX i\ l i lX ih l i l i l i l i l lLl&2< i l @t J i l Wpe8 i l  p++i l8 +< i< lD +iP l i l i lh i l  P i l Xi l   i  l Ti lD iL l i l i l8 ,l3\P >t LD iD lT X@i\ l i l bi+u0i  l i lL i l` 00 /` P i  l` ip 0@i l i l0 i, l i  i D ( t>l  i  l8 i (0l8 C8 N8 Y ` h&  s"L ~("  ' i l4 i8 l >>i l >i lt i l i l i l 3 i l d i l( 0 i0 l i l i l i  ld 0 3 4l i l! ip! A!< l$" i(" l" i" l% Ox>a|>i& l' i ' l' i' l' ni' l( w>i( l( >i( l$) 03l03>i() l|* * i* lh+ t+ it+ l(, 4, i4, l/  7 7i40 l`6 $6 i6 -07F@7 l`< i< l< _<X i< lH? i`? lX@ j>i\@ l@ i@ lA {A iA lA >@iA lH i8H 8: lK K$ iK lK H: iK lM @l@~iM l$N i4N lN PiN lP i P lQ "~9T: i$Q lV iV lX R_jpT0lT@A X iX lY B Y iY lZ iZ Z  lT[ iX[ l[ i[ l[ i\ l\ i\ l8] B iD] lp] ]X i] $] 4^ l4_ i8_ l` I`| i` W8ah cB|a, lc ic lf if li B ii ll  m i m BB lw i,x l`x idx ly iy ̂l{ ۂi{ l| i$| l| i| l(} i,} l, i l i\ l ix l\ iؔ l i lX l il lh it l i l̥ iХ  l i l  i lЪ iԪ l i l0 i4 lد iܯ % l @ i lL WP iP lx s0i| l i ,l( i@ 48HlԳ i l, i8 l i lL Dd@ id l i l i l 2@i lP ;iT lȹ U̹ i̹ l hlr|ȼD iȼ l i  l< i@ lx i| lԽ iؽ l Di l< iH i i i i i i i iT l i  l  i i$ l i i lh it l Dܖ0L.H   p + 440 BSPQ( d lT u l ,}@% x ,T  $D]@ %0<7I D4H Q ]< oVL XL H`Z`  T<Хl * $|`  y   & .`EllZxDp ؽ<  "4 @< t(#d<00B$ K z Z,l u̗dؗp $ 08d0   &,x8 4F X(, d l,x w   ,LX  4n, / (   l 1A@ =<\ Q8|cT p|< D|PV \` | ( h3= Kbt\ r4N@ ~_  < t \) L<\ \ R  @% L$  < #T@ 1 >TZ  cX  l( u LX[ l t$Q (  0 R$ $ Ș9  P tN$ Z Ԙj  p l  } | 4   X ܯ   ( 8 !`YT !1! :!|\ K!, X!x b!< ~!x ! !PT !@D !\ !D@ !#XU#b@ b#4 p#d #p#h$ #p #| #(b #Z  #?# $ $ !$-$L 8$8 G$\$ k$ $$<$ $X $(8 $4 $Ą$ $() $T$Ĭp %* % %\ /%̶ D%' S% c%ęPt%K %ЙL%ܙ`%\ %K %p %l% % &'&\8&4H&(, T&\ c&h4 t& |&&x^8 &n, &L & &  &p&>,  &,H &l & ,''&'X 6' P0 H'$ ]'0o'pn  y''8 'Ml '@ '[ '   ' ' 'd;'t (8(0 $(L= 3(<P(a(X x(ܻH (l (W (8t (t (H (0' (d:(((  ( )HL!)T43) 4 C) N) ])`Lo)l )' )$ ) )Ԫ )x`)x )  )'  ))t*T *%*, 8*J*L T* k*H~*T *R *̚0*S *ؚ$*| * + +{ -+P- 6+xG+0[+Tx i+ +( + + +X + +,<+K +T +8,D#, 3,D,PV, {p _,  p,H ,Zx ,d ,i ,\0,,@O ,h,-t--,-c :-K-\@ Y-, h- z-xQl --`? - -X7@ --\ - -t..L&.dx4 2.\ ?. P N. W.l w.ț.} .,$ .' ... .  . .|D / /  2/ԛD/XX ]/v/ġt /4 / /D /, /Q /t/0/|0x0T@ &030( G0 Y0 k0 0j  0 0[ 00D 0 0\, 0$ 0$| 0P 11`n 518  G1(tW1N p1< |14 1\0 10 1|T 1 1L 1@( initfini.c/home/elektranox/Desktop/gp2xdev/toolchain/glibc-2.3.5/build-gp2x/csu/crti.Scall_gmon_start$a$dabi-note.Sinit.ccrtstuff.c__CTOR_LIST____DTOR_LIST____EH_FRAME_BEGIN____JCR_LIST__completed.1637p.1636__do_global_dtors_auxcall___do_global_dtors_auxobject.1669frame_dummycall_frame_dummy__CTOR_END____DTOR_END____FRAME_END____JCR_END____do_global_ctors_auxcall___do_global_ctors_aux/home/elektranox/Desktop/gp2xdev/toolchain/glibc-2.3.5/build-gp2x/csu/crtn.Scmpt.cconnect.csockaddr_set_datasockaddr_sizeconnect_with_timeout_callback__PRETTY_FUNCTION__.5167transport_maptransport_map_modified_tickpoll_internallast_tick.5207last_fd.5206last_info.5205last_tick.5232last_fd.5231last_info.5230last_tick.5258last_fd.5257last_info.5256ip.4838should_bind.4837called.4836__PRETTY_FUNCTION__.4895convert.cwrite_backup_fileconverted_filesreplace_attrreplace_attr_refresh_hacklocal_quote_stringdissociate_urls_from_file_mapperdissociate_urls_from_filedl_file_url_map__PRETTY_FUNCTION__.4537downloaded_files_hashdf_free_mapperv4.4581v3.4580v2.4579v1.4578cookies.ccookie_newcookie_expired_pcookies_nowdelete_cookiefind_matching_cookiestore_cookie__PRETTY_FUNCTION__.3609update_cookie_fieldparse_set_cookiesnumeric_address_pcount_charpath_matches__PRETTY_FUNCTION__.3590known_toplevel_domains.3842cookie_matches_urlequality_comparatorgoodness_comparator__PRETTY_FUNCTION__.4119save_cookies_mappernuke_cookie_chainftp.cftp_expected_bytesprint_length__PRETTY_FUNCTION__.5119getftpdelelementfreefileinfoftp_loop_internal__PRETTY_FUNCTION__.5597depth.5591ftp_retrieve_listftp_retrieve_dirsftp_retrieve_globftp-basic.cftp_requestskey_head.4988__PRETTY_FUNCTION__.5039__PRETTY_FUNCTION__.5074__PRETTY_FUNCTION__.5096__PRETTY_FUNCTION__.5173__PRETTY_FUNCTION__.5195__PRETTY_FUNCTION__.5217__PRETTY_FUNCTION__.5244__PRETTY_FUNCTION__.5305__PRETTY_FUNCTION__.5426ftp-ls.cclean_linemonths.5355months.4870ftp_parse_unix_lsmonths.5186ftp-opie.cWpextractenglish.4174hash.cprimes.3456prime_sizecmp_pointerhash_stringcmp_stringhash_string_nocasestring_cmp_nocasehost.c__PRETTY_FUNCTION__.4212__PRETTY_FUNCTION__.4276cmp_prefer_ipv4cmp_prefer_ipv6address_list_deletegetaddrinfo_with_timeout_callbackbuf.4389is_valid_ipv4_address__PRETTY_FUNCTION__.4303host_name_addresses_map__PRETTY_FUNCTION__.4560__PRETTY_FUNCTION__.4613host_cleanup_mapperhtml-parse.c__PRETTY_FUNCTION__.3461convert_and_copyname_allowed__PRETTY_FUNCTION__.3612html-url.ctag_url_attributesadditional_attributesknown_tagstag_find_urlstag_handle_basetag_handle_formtag_handle_linktag_handle_metafind_attrappend_url__PRETTY_FUNCTION__.3757__PRETTY_FUNCTION__.3912collect_tags_mapperhttp.crelease_headerrequest_set_headerrequest_set_user_header__PRETTY_FUNCTION__.5084request_sendrequest_freeresponse_head_terminatorresp_header_locateresp_header_getresp_header_copyresp_header_strdup__PRETTY_FUNCTION__.5533skip_short_bodyinvalidate_persistentpconnpconn_activefree_hstattime_formats.6277basic_authentication_encodedump_hashoptions.6387realm.6381opaque.6382nonce.6383digest_authentication_encode__PRETTY_FUNCTION__.5165chunk.5156__PRETTY_FUNCTION__.5662gethttpwget_cookie_jarcookies_loaded_pcommandscmd_vectorcmd_booleancmd_numbercmd_stringcmd_timecmd_directorycmd_spec_dirstructcmd_bytescmd_directory_vectorcmd_spec_headercmd_spec_htmlifycmd_filecmd_spec_mirrorcmd_number_infcmd_lockable_booleancmd_spec_prefer_familycmd_spec_progresscmd_bytes_sumcmd_spec_recursivecmd_spec_restrict_file_namescmd_spec_timeoutcmd_spec_useragentcommand_by_nameparse_line__PRETTY_FUNCTION__.5147setval_internalrun_wgetrcenable_tilde_expansion__PRETTY_FUNCTION__.5164simple_atofparse_bytes_helperchoices.5613log.clog_line_currentflush_log_pfree_log_linelog_linessaved_appendtrailing_lineget_log_fpinhibit_logginglogfpneeds_flushinglog_vprintf_internalsave_context_p__PRETTY_FUNCTION__.4234ringpos.4232escnonprint_internalringcheck_redirect_outputredirect_request_signal_namemain.cprint_helpprint_versionprint_usagehelp.5365p.5301buffer.5300__PRETTY_FUNCTION__.5331short_optionslong_optionsoptmapredirect_output_signalgen-md5.cgnu-md5.cfillbufnetrc.cmaybe_add_to_listshift_leftprocessed_netrc.3416progress.cimplementationsdot_createdot_updatedot_finishdot_set_paramsbar_createbar_updatebar_finishbar_set_paramscurrent_impl_lockedcurrent_imploutput_redirected__PRETTY_FUNCTION__.4590print_percentageprint_download_speedshort_units.4850__PRETTY_FUNCTION__.4830create_imagedisplay_imagereceived_sigwinchscreen_widthptimer.cposix_clock_idposix_millisec_resolutionclocks.3820init_done.3874recur.curl_enqueueurl_dequeuedownload_child_p__PRETTY_FUNCTION__.5246__PRETTY_FUNCTION__.5071res.cadd_path__PRETTY_FUNCTION__.3630__PRETTY_FUNCTION__.3675free_specsregistered_specscleanup_hash_table_mapperretr.cdlbuf.5136limit_data__PRETTY_FUNCTION__.5214line_terminator__PRETTY_FUNCTION__.5284rate_names.5270res.5269first_retrieval.5420rewritten_storage.5479__PRETTY_FUNCTION__.5319safe-ctype.csnprintf.curl.csupported_schemesurlchr_tablefilechr_tableparse_errorsurl_unescape__PRETTY_FUNCTION__.4755url_escape_1url_escape_allow_passthrough__PRETTY_FUNCTION__.5210full_path_lengthfull_path_writeunescape_single_charappend_stringappend_char__PRETTY_FUNCTION__.5475append_uri_pathel__PRETTY_FUNCTION__.5852sync_path__PRETTY_FUNCTION__.4842__PRETTY_FUNCTION__.5078utils.coutput.4682output.4696unique_name_1proclistin_accliststring_set_to_array_mapperstring_set_free_mapperfree_keys_and_values_mapperinitialized.5238cached_grouping.5237cached_sep.5236outbuf.5245buf.5279powers.5278ringpos.5429ring.5428seeded.5453__PRETTY_FUNCTION__.5485abort_run_with_timeoutrun_with_timeout_envtbl.5533base64_char_to_value.5577mergesort_internalversion.cxmalloc.cmemfatal__PRETTY_FUNCTION__.3350libgcc2.celf-init.c__clz_tabfreeaddrinfo@@GLIBC_2.0ftp_process_typeconvert_all_linksdownloaded_file__aeabi_dcmplereadlink@@GLIBC_2.0__cmpdf2retrieve_treemkdir@@GLIBC_2.0hash_table_clear__eqdf2__divdi3version_string__strtoll_internal@@GLIBC_2.0fgetc@@GLIBC_2.0__floatdidfnumber_to_stringgen_md5_inithash_table_containsclock_getres@@GLIBC_2.2rename@@GLIBC_2.0url_errorferror@@GLIBC_2.0fd_read_hunkftp_responserun_commandstrchr@@GLIBC_2.0address_list_address_ataddress_list_set_faultyfdopen@@GLIBC_2.1is_valid_ipv6_addressdebug_logprintffeof@@GLIBC_2.0file_mergeftp_systtouchlog_initaprintfmatch_tail_DYNAMIC__gtdf2__rawmemchr@@GLIBC_2.1nanosleep@@GLIBC_2.0siglongjmp@@GLIBC_2.0getaddrinfo@@GLIBC_2.0cookie_handle_set_cookiechecking_strdup_bss_end____register_frame_info@@GLIBC_2.0__aeabi_cdcmplechecking_malloc0write@@GLIBC_2.0localtime@@GLIBC_2.0_sch_istablefileno@@GLIBC_2.0logflushconcat_stringsstrcmp@@GLIBC_2.0ftp_eprtclose@@GLIBC_2.0perror@@GLIBC_2.0has_html_suffix_pregister_downloadfprintf@@GLIBC_2.0timegm@@GLIBC_2.0fork@@GLIBC_2.0__aeabi_cdrcmplegetenv@@GLIBC_2.0accept_connectionxstrdup_lowersignal@@GLIBC_2.0fflush@@GLIBC_2.0__floatsidf__ltdf2vec_appendfd_transport_contextprogress_schedule_redirectunlink@@GLIBC_2.0address_list_set_connectedurl_set_dir__fini_array_endftp_indexlog_cleanupbind_local__udivsi3free_keys_and_valuesres_cleanupres_parse_from_fileselect@@GLIBC_2.0__fixunsdfsifile_non_directory_p__assert_fail@@GLIBC_2.0vsnprintf@@GLIBC_2.0address_list_get_boundsstrerror@@GLIBC_2.0ftp_pasv__bss_start__gen_md5_update__dso_handle__aeabi_ui2dfseeko64@@GLIBC_2.1exec_name__aeabi_drsubinteresting_attributes__libc_csu_finifree_urlposmkalldirsfd_readputchar@@GLIBC_2.0ftp_retrgetpwuid@@GLIBC_2.0frontcmp__aeabi_dcmplthash_table_getregister_delete_fileftp_epsvftp_get_listingregister_html__extendsfdf2__aeabi_ddiv__errno_location@@GLIBC_2.0__adddf3ftp_lpsvftp_restcookie_jar_loadmemchr@@GLIBC_2.0url_has_scheme__aeabi_dmulaccept@@GLIBC_2.0chmod@@GLIBC_2.0retrieve_url__floatunsidfaccess@@GLIBC_2.0downloaded_html_sethash_pointerinet_ntoa@@GLIBC_2.0progress_interactive_pprintwhatputs@@GLIBC_2.0_initsearch_netrcfile_exists_pread_file_freerandom_floatlisten@@GLIBC_2.0ftp_loopstring_set_containsescnonprintmalloc@@GLIBC_2.0fd_register_transportpretty_print_addresssetsid@@GLIBC_2.0fd_closechecking_reallocmd5_read_ctxlog_closelog_request_redirect_outputaccdirfork_to_backgroundlog_set_flushnumdigit__fixdfsifd_peekmake_string_hash_tableselect_fdfread@@GLIBC_2.0memmove@@GLIBC_2.0setitimer@@GLIBC_2.0fd_read_body__deregister_frame_info@@GLIBC_2.0free_vecfreopen64@@GLIBC_2.1strpbrk@@GLIBC_2.0sufmatch__aeabi_daddretrieve_from_file__ledf2run_with_timeoutstdout@@GLIBC_2.0__aeabi_ul2duri_merge__umodsi3ftp_pwdstderr@@GLIBC_2.0home_dirabort@@GLIBC_2.0escnonprint_uriurl_free__sigsetjmp@@GLIBC_2.0host_cleanupchecking_freesetsockopt@@GLIBC_2.0sysconf@@GLIBC_2.0save_cookiesgen_md5_context_sizegetpeername@@GLIBC_2.0accept_domainurl_escapevfprintf@@GLIBC_2.0__aeabi_dcmpgtsetoptvalftp_port__bss_end__free_netrcstring_set_addfnmatch@@GLIBC_2.2.3__aeabi_dcmpgelog_set_save_contexttime@@GLIBC_2.0mktime@@GLIBC_2.0__aeabi_dsub_startptimer_resethttp_cleanupopt__floatundidfptimer_newfgets@@GLIBC_2.0read_fileftp_listbase64_encodeconvert_cleanupregister_redirectionptimer_destroyread_whole_linefputs@@GLIBC_2.0fd_read_linestrstr@@GLIBC_2.0strlen@@GLIBC_2.0number_to_static_stringskey_responsecookie_jar_savenetrc_listprogress_finishstrptime@@GLIBC_2.0__strtol_internal@@GLIBC_2.0qsort@@GLIBC_2.0dl_url_file_map__aeabi_i2dscheme_disablecleanup_html_urllogputsoption_dataurl_full_pathurl_set_filelogprintf__divdf3http_loopoutput_streamftp_parse_lsfopen_excl__muldf3strncmp@@GLIBC_2.0__fini_array_startfputc@@GLIBC_2.0__libc_csu_inithash_table_remove__xstat64@@GLIBC_2.2memcmp@@GLIBC_2.0url_parse__bss_startset_progress_implementationretr_rateres_retrieve_filescheme_default_portmaincleanup__div0_sch_tolowertotal_downloaded_bytesftp_last_resplineftp_lprtres_match_path__libc_start_main@@GLIBC_2.0__init_array_enddetermine_screen_widthstable_sort__aeabi_l2daddress_list_containsrandom_numberunique_createhas_wildcards_pftp_type_sch_toupper__end__ptimer_readmd5_process_bytesrealloc@@GLIBC_2.0strcat@@GLIBC_2.0checking_mallocdata_startgen_md5_finishprintf@@GLIBC_2.0bind@@GLIBC_2.0ftp_cwd__fixunsdfdi__nedf2suffixgetuid@@GLIBC_2.0sepstring_finiprogress_handle_sigwinchmemcpy@@GLIBC_2.0ftello64@@GLIBC_2.1human_readableopen64@@GLIBC_2.1with_thousand_sepsfclose@@GLIBC_2.1__fixdfdigetsockname@@GLIBC_2.0strrchr@@GLIBC_2.0hash_table_putmake_nocase_string_hash_table__strdup@@GLIBC_2.0hash_table_get_pairgetopt_long@@GLIBC_2.0progress_createfopen64@@GLIBC_2.1symlink@@GLIBC_2.0datetime_strftp_sizesrand@@GLIBC_2.0snprintf@@GLIBC_2.0base64_decode__lxstat64@@GLIBC_2.2ptimer_resolutionhttp_atotmxsleepaddress_list_releasestrcasecmp@@GLIBC_2.0inet_ntop@@GLIBC_2.0calc_rate__aeabi_d2uizgai_strerror@@GLIBC_2.1exit@@GLIBC_2.0connect_to_hostinteresting_tagscalloc@@GLIBC_2.0time_str__aeabi_uidivmod__aeabi_dcmpequrl_schemeretryable_socket_connect_errorurl_stringsscanf@@GLIBC_2.0_edatahash_table_new_IO_putc@@GLIBC_2.0_GLOBAL_OFFSET_TABLE_free@@GLIBC_2.0_endioctl@@GLIBC_2.0url_file_nameutime@@GLIBC_2.0res_get_specscookie_jar_newisatty@@GLIBC_2.0hash_table_mapmemset@@GLIBC_2.0res_register_specsinitializeres_parsestrncasecmp@@GLIBC_2.0fd_writecookie_headerconnect@@GLIBC_2.0stdin@@GLIBC_2.0redirect_requeststrdupdelim__aeabi_d2izrotate_backups__modsi3valid_progress_implementation_pstrncpy@@GLIBC_2.0get_urls_htmlstring_set_freeptimer_measure__init_array_startoptarg@@GLIBC_2.0make_directory__moddi3merge_vecsadd_thousand_seps_IO_stdin_usedsocket_ip_addressstrtok@@GLIBC_2.0address_list_connected_pclock_gettime@@GLIBC_2.2test_socket_open__aeabi_cdcmpeq__gedf2progress_updatemd5_finish_ctxhash_table_countrecv@@GLIBC_2.0sprintf@@GLIBC_2.0output_stream_regularfwrite@@GLIBC_2.0__aeabi_f2d__data_startstring_set_to_arraysocket@@GLIBC_2.0html_quote_string_Jv_RegisterClassesmap_html_tags__subdf3lookup_hostrand@@GLIBC_2.0md5_init_ctxacceptablerewrite_shorthand_urlremove_linkconnect_to_iphash_table_destroyoptind@@GLIBC_2.0schemes_are_similar_pmd5_process_blockread@@GLIBC_2.0sleep_between_retrievalsunique_name__fxstat64@@GLIBC_2.2ftp_logincookie_jar_deletefile_size__gmon_start__strcpy@@GLIBC_2.0get_urls_file